TMEM166 Antibody - BSA Free

Western Blot: TMEM166 Antibody [NBP2-83678] - WB Suggested Anti-TMEM166 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: 293T cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TMEM166 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TMEM166 Antibody - BSA Free (NBP2-83678) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMEM166. Peptide sequence: AALVIRISCHTDCRRRPGKKFLQDRESSSDSSDSEDGSEDTVSDLSVRRH The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: EVA1A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TMEM166 Antibody - BSA Free

• family with sequence similarity 176, member A
• TMEM166
• Transmembrane protein 166FLJ13391

Background

FUNCTION: Acts as a regulator of programmed cell death, mediating both autophagy and apoptosis. SUBCELLULAR LOCATION: Endoplasmic reticulum membrane; Single-pass membrane protein. Lysosome membrane; Single-pass membrane protein. TISSUE SPECIFICITY: Expressed in lung, kidney, liver, pancreas, placenta, but not in heart and skeletal muscle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: EVA1A