TMEM11 Antibody (H00008834-B01P)

Images

 
Western Blot: TMEM11 Antibody [H00008834-B01P] - Analysis of TMEM11 expression in transfected 293T cell line by TMEM11 polyclonal antibody. Lane 1: TMEM11 transfected lysate(21.50 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TMEM11 Antibody Summary

Immunogen
TMEM11 (NP_003867.1, 1 a.a. - 192 a.a.) full-length human protein. MAAWGRRRLGPGSSGGSARERVSLSATDCYIVHEIYNGENAQDQFEYELEQALEAQYKYIVIEPTRIGDETARWITVGNCLHKTAVLAGTACLFTPLALPLDYSHYISLPAGVLSLACCTLYGISWQFDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TMEM11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TMEM11 Antibody

  • C17orf35
  • chromosome 17 open reading frame 35
  • PM1putative receptor protein
  • PMI
  • Protein PM1
  • Protein PMI
  • transmembrane protein 11

Background

The function of putative receptor protein is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02043
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87729
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56561
Species: Hu, Mu, Rt
Applications: WB
NBP1-43312
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NB600-501
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, Fi, GP, Ha, Le, Ma, Pm, Rb, Sh, Sq, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005542-R06
Species: Hu
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-57753
Species: Hu
Applications: WB, ICC/IF
H00001446-D01P
Species: Hu, Mu
Applications: WB
AF2667
Species: Hu
Applications: WB, IHC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008834-B01P
Species: Hu
Applications: WB

Publications for TMEM11 Antibody (H00008834-B01P) (0)

There are no publications for TMEM11 Antibody (H00008834-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM11 Antibody (H00008834-B01P) (0)

There are no reviews for TMEM11 Antibody (H00008834-B01P). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM11 Antibody (H00008834-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM11 Products

Related Products by Gene

Bioinformatics Tool for TMEM11 Antibody (H00008834-B01P)

Discover related pathways, diseases and genes to TMEM11 Antibody (H00008834-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for TMEM11 Antibody (H00008834-B01P)

View related products by pathway.

Blogs on TMEM11

There are no specific blogs for TMEM11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM11
Uniprot