TMEM106C Antibody


Immunohistochemistry-Paraffin: TMEM106C Antibody [NBP2-13442] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: TMEM106C Antibody [NBP2-13442] - Staining of human kidney shows strong granular cytoplasmic positivity in renal tubules.
Immunohistochemistry-Paraffin: TMEM106C Antibody [NBP2-13442] - Staining of human parathyroid gland shows high expression.
Immunohistochemistry-Paraffin: TMEM106C Antibody [NBP2-13442] - Staining in human parathyroid gland and skeletal muscle tissues using anti-TMEM106C antibody. Corresponding TMEM106C RNA-seq data are presented for the more

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

TMEM106C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: SVKISYIGLMTQSSLETHHYVDCGGNSTAI
Specificity of human TMEM106C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM106C Protein (NBP2-13442PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TMEM106C Antibody

  • EMOC
  • Endoplasmic reticulum membrane protein overexpressed in cancer
  • MGC111210
  • MGC5576
  • transmembrane protein 106C


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P

Publications for TMEM106C Antibody (NBP2-13442) (0)

There are no publications for TMEM106C Antibody (NBP2-13442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM106C Antibody (NBP2-13442) (0)

There are no reviews for TMEM106C Antibody (NBP2-13442). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TMEM106C Antibody (NBP2-13442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TMEM106C Products

Bioinformatics Tool for TMEM106C Antibody (NBP2-13442)

Discover related pathways, diseases and genes to TMEM106C Antibody (NBP2-13442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM106C Antibody (NBP2-13442)

Discover more about diseases related to TMEM106C Antibody (NBP2-13442).

Blogs on TMEM106C

There are no specific blogs for TMEM106C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TMEM106C Antibody and receive a gift card or discount.


Gene Symbol TMEM106C