Elp3 Antibody

Images

 
Western Blot: Elp3 Antibody [NBP1-84625] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-183
Immunohistochemistry-Paraffin: Elp3 Antibody [NBP1-84625] - Staining of human fallopian tube shows moderate cytoplasmic positivity in glandular cells.
Western Blot: Elp3 Antibody [NBP1-84625] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Elp3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELWKSGRYKSYSPSDLVELVARILALVPPWTRVYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGIQCRDVRTREVGIQEIHHKVRPYQVELVRR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ELP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Elp3 Protein (NBP1-84625PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Elp3 Antibody

  • EC 2.3.1.48
  • elongation protein 3 homolog (S. cerevisiae)
  • elongator complex protein 3
  • hELP3
  • KAT9FLJ10422

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76788
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-47473
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16321
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-07996
Species: Hu
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-85250
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91733
Species: Hu
Applications: WB, IHC, IHC-P
H00080333-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-28870
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP1-81176
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81696
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Elp3 Antibody (NBP1-84625) (0)

There are no publications for Elp3 Antibody (NBP1-84625).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Elp3 Antibody (NBP1-84625) (0)

There are no reviews for Elp3 Antibody (NBP1-84625). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Elp3 Antibody (NBP1-84625) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Elp3 Products

Bioinformatics Tool for Elp3 Antibody (NBP1-84625)

Discover related pathways, diseases and genes to Elp3 Antibody (NBP1-84625). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Elp3 Antibody (NBP1-84625)

Discover more about diseases related to Elp3 Antibody (NBP1-84625).
 

Pathways for Elp3 Antibody (NBP1-84625)

View related products by pathway.

PTMs for Elp3 Antibody (NBP1-84625)

Learn more about PTMs related to Elp3 Antibody (NBP1-84625).

Blogs on Elp3

There are no specific blogs for Elp3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Elp3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ELP3