Recombinant Human TMEM1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TMEM1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1162-1257 of Human TMEM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VRLFKYLPHHSAHSSQLDADSWIENDSLSVDKHGDDQPDSSSLKSRGSVHSACSSEHKGLPMPRLQALPAGQVFNSSSGTQVLVIPSQDDHVLEVS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRAPPC10

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TMEM1 Protein

  • EHOC-1FLJ55683
  • EHOC1GT334
  • Epilepsy holoprosencephaly candidate 1 protein
  • epilepsy holoprosencephaly candidate-1 protein
  • FLJ54223
  • FLJ54817
  • Protein GT334
  • TMEM1MGC126777
  • trafficking protein particle complex 10
  • trafficking protein particle complex subunit 10
  • trafficking protein particle complex subunit 130
  • Trafficking protein particle complex subunit TMEM1
  • transmembrane protein 1
  • Transport protein particle subunit TMEM1
  • TRAPP 130 kDa subunit
  • TRAPP subunit TMEM1
  • TRS130
  • TRS30

Background

TMEM1 - transmembrane protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55735
Species: Hu, Mu, Bv, Ca, Ch, Pm
Applications: WB, ICC/IF, IP
NBP1-89345
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-55113
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84884
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-52582
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
AF6260
Species: Hu
Applications: WB
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
NBP2-54619
Species: Hu, Mu
Applications: WB, ChIP, DB, ELISA, IF
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00003954-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-86663
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-35213
Species: Hu
NBP1-85934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-360
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00007109-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for TMEM1 Partial Recombinant Protein (H00007109-Q01) (0)

There are no publications for TMEM1 Partial Recombinant Protein (H00007109-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM1 Partial Recombinant Protein (H00007109-Q01) (0)

There are no reviews for TMEM1 Partial Recombinant Protein (H00007109-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM1 Partial Recombinant Protein (H00007109-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEM1 Products

Bioinformatics Tool for TMEM1 Partial Recombinant Protein (H00007109-Q01)

Discover related pathways, diseases and genes to TMEM1 Partial Recombinant Protein (H00007109-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM1 Partial Recombinant Protein (H00007109-Q01)

Discover more about diseases related to TMEM1 Partial Recombinant Protein (H00007109-Q01).
 

Pathways for TMEM1 Partial Recombinant Protein (H00007109-Q01)

View related products by pathway.

Blogs on TMEM1

There are no specific blogs for TMEM1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-2 [Unconjugated]
202-IL-010/CF
TMEM1 Antibody (5B4)
H00007109-M01
ATP7b Antibody
NB100-360

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TMEM1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAPPC10