TMEFF2/Tomoregulin-2 Recombinant Protein Antigen

Images

 
There are currently no images for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TMEFF2/Tomoregulin-2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEFF2.

Source: E. coli

Amino Acid Sequence: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TMEFF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84362.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TMEFF2/Tomoregulin-2 Recombinant Protein Antigen

  • CT120.2
  • HPP1member 2
  • Hyperplastic polyposis protein 1
  • TENB2
  • TMEFF2
  • Tomoregulin2
  • Tomoregulin-2
  • TPEFtomoregulin
  • TR-2
  • transmembrane protein TENB2
  • transmembrane protein with EGF-like and two follistatin-like domains 2
  • Transmembrane protein with EGF-like and two follistatin-like domains
  • TRtomoregulin-2

Background

TMEFF2(transmembrane protein with EGF-like and two follistatin-like domains 2), a gene encoding a plasma membrane protein with two follistatin-like domains and one epidermal growth factor-like domain, had limited normal tissue distribution and was highly overexpressed in prostate cancer. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. Down-regulated in tumor cell lines in response to a high level of methylation in the 5' region. Clone J4B6, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human TMEFF2 protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
7770-GT
Species: Hu
Applications: EnzAct
NBP2-93808
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-28863
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF5724
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-16684
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-69023
Species: Mu
Applications: WB
NBP1-82756
Species: Hu
Applications: IHC, IHC-P
NBP3-46820
Species: Hu
Applications: ELISA, IHC, WB
NB200-310
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
NB100-317
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF2009
Species: Hu
Applications: ICC, IHC
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow

Publications for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP) (0)

There are no publications for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP) (0)

There are no reviews for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TMEFF2/Tomoregulin-2 Products

Research Areas for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP)

Find related products by research area.

Blogs on TMEFF2/Tomoregulin-2

There are no specific blogs for TMEFF2/Tomoregulin-2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TMEFF2/Tomoregulin-2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEFF2