TMEFF2/Tomoregulin-2 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TMEFF2. Source: E. coli
Amino Acid Sequence: FPTSLSDCQTPTGWNCSGYDDRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAACKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDA Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TMEFF2 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84362. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
32 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TMEFF2/Tomoregulin-2 Recombinant Protein Antigen
Background
TMEFF2(transmembrane protein with EGF-like and two follistatin-like domains 2), a gene encoding a plasma membrane protein with two follistatin-like domains and one epidermal growth factor-like domain, had limited normal tissue distribution and was highly overexpressed in prostate cancer. The shedded form up-regulates cancer cell proliferation, probably by promoting ERK1/2 phosphorylation. Down-regulated in tumor cell lines in response to a high level of methylation in the 5' region. Clone J4B6, is derived from hybridization of mouse F0 myeloma cells with spleen cells from BALB/c mice immunized with a recombinant human TMEFF2 protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: EM, IHC, IHC-P, WB
Species: Mu
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, IHC
Species: Bv, Hu, Mu
Applications: ICC, IHC
Publications for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP) (0)
There are no publications for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP) (0)
There are no reviews for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP) (0)
Additional TMEFF2/Tomoregulin-2 Products
Research Areas for TMEFF2/Tomoregulin-2 Protein (NBP1-84362PEP)
Find related products by research area.
|
Blogs on TMEFF2/Tomoregulin-2