Home » Tm9sf3 » Tm9sf3 Proteins » Tm9sf3 Recombinant Protein Antigen

Tm9sf3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Tm9sf3 Protein (NBP1-80736PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

Tm9sf3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TM9SF3.

Source: E.coli

Amino Acid Sequence: SLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWG
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TM9SF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80736.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Tm9sf3 Recombinant Protein Antigen

  • transmembrane 9 superfamily member 3

Background

Tm9sf3 is a gene that codes for a multi-pass membrane protein that is 589 amino acids long and weighs approximately 68 kDa. Current studies are being done on diseases and disorders related to this gene including Alzheimer's disease and malaria. Tm9sf3 has also been shown to have interactions with UNC93B1, SYS1, UBC, and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HSD17B4 Antibody
(OTI4C4)
NBP2-46005
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY HSD17B4.
Immunofluorescence: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of HeLa cells.
Immunohistochemistry: HSD17B4 Antibody (OTI4C4) [NBP2-46005] - Analysis of Human Ovary tissue.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
D Box Binding
Protein Antibody
NBP2-83997
Immunohistochemistry: D Box Binding Protein Antibody [NBP2-83997] - Human Liver
Western Blot: D Box Binding Protein Antibody [NBP2-83997] - WB Suggested Anti-DBP Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Western Blot: D Box Binding Protein Antibody [NBP2-83997] - Host: Rabbit. Target Name: DBP. Sample Tissue: Human Hela Whole Cell. Antibody Dilution: 1ug/ml
Species: Hu
Applications: IHC, IHC-P, WB
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(199 Publications)
Species: Hu
Applications: BA
Vitamin D BP
Antibody
NBP1-88027
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis using Anti-GC antibody NBP1-88027 (A) shows similar pattern to independent antibody NBP1-88028 (B).
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Western Blot: Vitamin D BP Antibody [NBP1-88027] - Equine adult and embryonic liver cell lysates. WB image submitted by a verified customer review.
(2 Reviews)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Human liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunohistochemistry: Ceruloplasmin Antibody (6C3K9) [NBP3-15868] - Immunofluorescence analysis of rat liver using Ceruloplasmin Rabbit mAb (NBP3-15868) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse brain corpus callosum. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MBP Antibody (12) [NB600-717] - Histological and mRNA analysis of the inflammatory cytokines in the vehicle- or etifoxine-treated mice at onset of clinical symptoms. At day 10 p.i., drug treated animals showed significant differences in MBP staining. Animals treated with etifoxine showed an increase in retention of percentage of MBP coverage (*p = 0.001). Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/cgi/doi/10.1002/emmm.201202124), licensed under a CC-BY licence.
(3 Reviews)
(29 Publications)
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
MBL Antibody
AF2307
MBL Antibody
(6 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(9 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
PRG2 Antibody
NBP3-04784
Western Blot: PRG2 Antibody [NBP3-04784] - Analysis of extracts of Mouse liver, using PRG2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: PRG2 Antibody [NBP3-04784] - Human placenta using PRG2 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Immunocytochemistry/Immunofluorescence: PRG2 Antibody [NBP3-04784] - Immunofluorescence analysis of C6 cells using PRG2 Rabbit pAb (NBP3-04784) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
gamma-glutamyl
hydrolase Antibody
NBP1-90927
Western Blot: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Analysis in control (vector only transfected HEK293T lysate) and GGH over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: gamma-glutamyl hydrolase Antibody [NBP1-90927] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
RGL4 Antibody
NBP2-20145
Western Blot: RGL4 Antibody [NBP2-20145] - Sample (30 ug of whole cell lysate) A: U87-MG 10% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: RGL4 Antibody [NBP2-20145] - Immunohistochemical analysis of paraffin-embedded colon ca, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
RAPGEF5 Antibody
NBP2-57362
Western Blot: RAPGEF5 Antibody [NBP2-57362] - Analysis in human cell line RT-4, human cell line U-251 MG and human plasma.
Immunocytochemistry/Immunofluorescence: RAPGEF5 Antibody [NBP2-57362] - Staining of human cell line PC-3 shows localization to nucleoplasm & nuclear bodies.
Species: Hu
Applications: ICC/IF, WB
KIF22 Antibody
(1E3)
NBP2-37550
ELISA: KIF22 Antibody (1E3) [NBP2-37550] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
Western Blot: KIF22 Antibody (1E3) [NBP2-37550] - Aalysis using KID mAb against human KID (AA: 225-419) recombinant protein. (Expected MW is 47 kDa)
Western Blot: KIF22 Antibody (1E3) [NBP2-37550] - Analysis using KID mAb against HEK293 (1) and KID(AA: 225-419)-hIgGFc transfected HEK293 (2) cell lysate.
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
alpha
1-Microglobulin Antib
MAB7724
alpha 1-Microglobulin was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Mouse Anti-Human alpha 1-Microglobulin Monoclonal Antibody (Catalog # MAB7724) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of human liver tissue, Hep3B human hepatocellular carcinoma cell line, HepG2 human hepatocellular carcinoma cell line, and Huh‑7 human hepatoma cell line. PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human alpha 1‑Microglobulin Monoclonal Antibody (Catalog # MAB7724) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for alpha 1‑Microglobulin at approximately 30 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Hu
Applications: ICC, WB
CD117/c-kit
Antibody [Unconjugate
AF1356
Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
Western blot shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line, and MC/9‑2 mouse mast cell line. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for CD117/c-kit at approximately 135, 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
CD117/c-kit was detected in immersion fixed frozen sections of mouse embryo using Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(4 Reviews)
(51 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
p38 delta/SAPK4
Antibody [Unconjugate
AF1519
Western blot shows lysates of HEK293 human embryonic kidney cell line and HepG2 human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.1 µg/mL Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). For additional reference, recombinant p38 beta , p38 gamma , p38δ, and p38 alpha   at 2 ng/lane) were included. A specific band for p38 delta was detected at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
p38δ was detected in immersion fixed paraffin-embedded sections of human skin using 15 µg/mL Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) overnight at 4 °C. Tissue was stained with the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
p38δ was detected in immersion fixed paraffin-embedded sections of human skin using Rabbit Anti-Human p38δ Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1519) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Publication)
Species: Hu
Applications: IHC, WB
Lipocalin-13
Antibody
AF7974
Western blot shows lysates of mouse liver tissue, mouse skeletal muscle tissue, mouse epididymis tissue, and mouse mammary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Mouse Lipocalin-13 Antigen Affinity-purified Poly­clonal Antibody (Catalog # AF7974) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Lipocalin-13 at approximately 27 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Publication)
Species: Mu
Applications: WB
LANCL1 Antibody
NBP1-81796
Immunocytochemistry/Immunofluorescence: LANCL1 Antibody [NBP1-81796] - Immunofluorescent staining of human cell line A-431 shows localization to microtubules.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human fallopian tube shows moderate positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: LANCL1 Antibody [NBP1-81796] - Staining of human kidney shows weak membranous positivity in cells in tubules.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Tm9sf3 Recombinant
Protein Antigen
NBP1-80736PEP
Tm9sf3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Tm9sf3 Protein (NBP1-80736PEP) (0)

There are no publications for Tm9sf3 Protein (NBP1-80736PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tm9sf3 Protein (NBP1-80736PEP) (0)

There are no reviews for Tm9sf3 Protein (NBP1-80736PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tm9sf3 Protein (NBP1-80736PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tm9sf3 Products

Array NBP1-80736PEP

Bioinformatics Tool for Tm9sf3 Protein (NBP1-80736PEP)

Discover related pathways, diseases and genes to Tm9sf3 Protein (NBP1-80736PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tm9sf3 Protein (NBP1-80736PEP)

Discover more about diseases related to Tm9sf3 Protein (NBP1-80736PEP).
 

Pathways for Tm9sf3 Protein (NBP1-80736PEP)

View related products by pathway.

Research Areas for Tm9sf3 Protein (NBP1-80736PEP)

Find related products by research area.

Blogs on Tm9sf3

There are no specific blogs for Tm9sf3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Simple Western lane view shows lysates of MO7e human megakaryocytic leukemic cell line, P815 mouse mastocytoma cell line and MC/9-2 mouse mast cell line, loaded at 0.2 mg/mL. A specific band was detected for CD117/c-kit at approximately 150-165 kDa (as indicated) using 5 µg/mL of Goat Anti-Human/Mouse CD117/c-kit Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1356) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.        
CD117/c-kit Antibody [Unconjugated]
AF1356
Immunohistochemistry-Frozen: MBP Antibody (12) [NB600-717] - Staining of MBP in mouse spinal cord ventral white matter. Image from verified customer review.
MBP Antibody (12)
NB600-717

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tm9sf3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol TM9SF3