Tm9sf3 Recombinant Protein Antigen

Images

 
There are currently no images for Tm9sf3 Protein (NBP1-80736PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tm9sf3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TM9SF3.

Source: E.coli

Amino Acid Sequence: SLPFCVGSKKSISHYHETLGEALQGVELEFSGLDIKFKDDVMPATYCEIDLDKEKRDAFVYAIKNHYWYQMYIDDLPIWG

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TM9SF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80736.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Tm9sf3 Recombinant Protein Antigen

  • transmembrane 9 superfamily member 3

Background

Tm9sf3 is a gene that codes for a multi-pass membrane protein that is 589 amino acids long and weighs approximately 68 kDa. Current studies are being done on diseases and disorders related to this gene including Alzheimer's disease and malaria. Tm9sf3 has also been shown to have interactions with UNC93B1, SYS1, UBC, and ELAVL1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, IP, PLA, WB
NBP2-83997
Species: Hu
Applications: IHC, IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-88027
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
NBP3-15868
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB600-717
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
AF2307
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP3-04784
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-20145
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-57362
Species: Hu
Applications: ICC/IF, WB
NBP2-37550
Species: Hu
Applications: ELISA, Flow, IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
MAB7724
Species: Hu
Applications: ICC, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
AF1519
Species: Hu
Applications: IHC, WB
AF7974
Species: Mu
Applications: WB
NBP1-81796
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80736PEP
Species: Hu
Applications: AC

Publications for Tm9sf3 Protein (NBP1-80736PEP) (0)

There are no publications for Tm9sf3 Protein (NBP1-80736PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tm9sf3 Protein (NBP1-80736PEP) (0)

There are no reviews for Tm9sf3 Protein (NBP1-80736PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tm9sf3 Protein (NBP1-80736PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tm9sf3 Products

Array NBP1-80736PEP

Bioinformatics Tool for Tm9sf3 Protein (NBP1-80736PEP)

Discover related pathways, diseases and genes to Tm9sf3 Protein (NBP1-80736PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tm9sf3 Protein (NBP1-80736PEP)

Discover more about diseases related to Tm9sf3 Protein (NBP1-80736PEP).
 

Pathways for Tm9sf3 Protein (NBP1-80736PEP)

View related products by pathway.

Research Areas for Tm9sf3 Protein (NBP1-80736PEP)

Find related products by research area.

Blogs on Tm9sf3

There are no specific blogs for Tm9sf3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tm9sf3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TM9SF3