TM9SF2 Recombinant Protein Antigen

Images

 
There are currently no images for TM9SF2 Protein (NBP1-80958PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TM9SF2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TM9SF2.

Source: E.coli

Amino Acid Sequence: LFVNRLDSVESVLPYEYTAFDFCQASEGKRPSENLGQVLFGERIEPSPYKFTFNKKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCYDVEDGQRF

Protein/Peptide Type
Recombinant Protein Antigen
Gene
TM9SF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-80958.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TM9SF2 Recombinant Protein Antigen

  • FLJ26287
  • MGC117391
  • P76
  • transmembrane 9 superfamily member 2
  • transmembrane protein 9 superfamily member 2,76 kDa membrane protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1970
Species: Hu
Applications: WB, Simple Western, IHC
H00010963-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
AF2485
Species: Hu
Applications: WB, IHC, IP
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02148
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
NBP1-23000
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB200-191
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24482
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB
NBP2-32382
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-26642
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90149
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80963
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87381
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-31164
Species: Hu
Applications: WB, ICC/IF
H00055697-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-355
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-80958PEP
Species: Hu
Applications: AC

Publications for TM9SF2 Protein (NBP1-80958PEP) (0)

There are no publications for TM9SF2 Protein (NBP1-80958PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM9SF2 Protein (NBP1-80958PEP) (0)

There are no reviews for TM9SF2 Protein (NBP1-80958PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TM9SF2 Protein (NBP1-80958PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TM9SF2 Products

Bioinformatics Tool for TM9SF2 Protein (NBP1-80958PEP)

Discover related pathways, diseases and genes to TM9SF2 Protein (NBP1-80958PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM9SF2 Protein (NBP1-80958PEP)

Discover more about diseases related to TM9SF2 Protein (NBP1-80958PEP).
 

Pathways for TM9SF2 Protein (NBP1-80958PEP)

View related products by pathway.

PTMs for TM9SF2 Protein (NBP1-80958PEP)

Learn more about PTMs related to TM9SF2 Protein (NBP1-80958PEP).

Blogs on TM9SF2

There are no specific blogs for TM9SF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TM9SF2 Antibody
NBP1-80958

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TM9SF2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TM9SF2