TM9SF4 Antibody - BSA Free

Western Blot: TM9SF4 Antibody [NBP2-32382] - Lane 1: Marker [kDa] 250, 130, 100,70,55,35,25,15,10. Lane 2: Human cell line CACO-2.

Immunocytochemistry/Immunofluorescence: TM9SF4 Antibody [NBP2-32382] - Staining of human cell line CACO-2 shows localization to mitochondria. Antibody staining is shown in green.

Simple Western: TM9SF4 Antibody [NBP2-32382] - Simple Western lane view shows a specific band for TM9SF4 in 0.2 mg/ml of HT-29 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: TM9SF4 Antibody [NBP2-32382] - Electropherogram image of the corresponding Simple Western lane view. TM9SF4 antibody was used at 1:25 dilution on HT-29 lysate(s) respectively.

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] - staining of human rectum shows strong cytoplasmic granular positivity in glandular cells.

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -Staining of human cerebral cortex shows strong cytoplasmic granular positivity in neurons.

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -Staining of human kidney shows strong cytoplasmic granular positivity in cells in tubules.

Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] -Staining of human prostate shows strong cytoplasmic granular positivity in smooth muscle cells and glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TM9SF4 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
• Predicted Species: Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TM9SF4
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Simple Western 1:25
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TM9SF4 Protein (NBP2-32382PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TM9SF4 Antibody - BSA Free

• KIAA0255dJ836N17.2
• transmembrane 9 superfamily member 4
• transmembrane 9 superfamily protein member 4

Background

TM9SF4 is a gene that codes for a multi-pass membrane protein that is 642 amino acids long and weighs approximately 75 kDa. Current studies are being done on diseases and disorders linked to this gene including melanoma and malaria. TM9SF4 has also been shown to have interactions with RAB5A, ARCN1, UBC, HSP90AA1, and ATP13A1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TM9SF4