TM9SF4 Antibody

Images

 
Western Blot: TM9SF4 Antibody [NBP2-32382] - Lane 1: Marker [kDa] 250, 130, 100,70,55,35,25,15,10. Lane 2: Human cell line CACO-2.
Immunocytochemistry/ Immunofluorescence: TM9SF4 Antibody [NBP2-32382] - Immunofluorescent staining of human cell line CACO-2 shows localization to mitochondria.
Immunohistochemistry-Paraffin: TM9SF4 Antibody [NBP2-32382] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Simple Western: TM9SF4 Antibody [NBP2-32382] - Simple Western lane view shows a specific band for TM9SF4 in 0.2 mg/ml of HT-29 lysate(s). This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: TM9SF4 Antibody [NBP2-32382] - Electropherogram image of the corresponding Simple Western lane view. TM9SF4 antibody was used at 1:25 dilution on HT-29 lysate(s) respectively.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TM9SF4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EDYYVHLIADNLPVATRLELYSNRDSDDKKKEKDVQFEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TM9SF4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TM9SF4 Protein (NBP2-32382PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TM9SF4 Antibody

  • KIAA0255dJ836N17.2
  • transmembrane 9 superfamily member 4
  • transmembrane 9 superfamily protein member 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-13253
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80958
Species: Hu
Applications: IHC, IHC-P
MAB3915
Species: Hu, Mu
Applications: WB
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP1-80584
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56715
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80736
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2307
Species: Hu
Applications: WB
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-32445
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19882
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for TM9SF4 Antibody (NBP2-32382) (0)

There are no publications for TM9SF4 Antibody (NBP2-32382).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM9SF4 Antibody (NBP2-32382) (0)

There are no reviews for TM9SF4 Antibody (NBP2-32382). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TM9SF4 Antibody (NBP2-32382) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TM9SF4 Products

Bioinformatics Tool for TM9SF4 Antibody (NBP2-32382)

Discover related pathways, diseases and genes to TM9SF4 Antibody (NBP2-32382). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TM9SF4 Antibody (NBP2-32382)

Discover more about diseases related to TM9SF4 Antibody (NBP2-32382).
 

Pathways for TM9SF4 Antibody (NBP2-32382)

View related products by pathway.

Blogs on TM9SF4

There are no specific blogs for TM9SF4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TM9SF4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TM9SF4