TM2D2 Antibody


Immunohistochemistry-Paraffin: TM2D2 Antibody [NBP2-30462] - Staining of human gallbladder shows moderate cytoplasmic positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P

Order Details

TM2D2 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: TASQELGYGCLKFGGQAYSDVEHTSVQCHALDGIECASPRTFLRENKPCIKYTG
Specificity of human TM2D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (91%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TM2D2 Protein (NBP2-30462PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TM2D2 Antibody

  • BBP-like protein 1
  • Beta-amyloid-binding protein-like protein 1
  • BLP1MGC125814
  • MGC125813
  • TM2 domain containing 2
  • TM2 domain-containing protein 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IF
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, Flow-IC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TM2D2 Antibody (NBP2-30462) (0)

There are no publications for TM2D2 Antibody (NBP2-30462).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TM2D2 Antibody (NBP2-30462) (0)

There are no reviews for TM2D2 Antibody (NBP2-30462). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TM2D2 Antibody (NBP2-30462) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TM2D2 Products

Bioinformatics Tool for TM2D2 Antibody (NBP2-30462)

Discover related pathways, diseases and genes to TM2D2 Antibody (NBP2-30462). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TM2D2

There are no specific blogs for TM2D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TM2D2 Antibody and receive a gift card or discount.


Gene Symbol TM2D2