TIMP-3 Antibody (1D8) Summary
Immunogen |
TIMP3 (AAH14277, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP |
Specificity |
TIMP3 - TIMP metallopeptidase inhibitor 3 (Sorsby fundus dystrophy, pseudoinflammatory) (1D8) |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TIMP3 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
It has been used for ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TIMP-3 Antibody (1D8)
Background
This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: ELISA
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Publications for TIMP-3 Antibody (H00007078-M01) (0)
There are no publications for TIMP-3 Antibody (H00007078-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TIMP-3 Antibody (H00007078-M01) (0)
There are no reviews for TIMP-3 Antibody (H00007078-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for TIMP-3 Antibody (H00007078-M01). (Showing 1 - 1 of 1 FAQ).
-
What I need is an antibody to human TIMP-3 that works in ELISA. It seems you offer 2 such products now, NBP1-67707 and H00007078-M01. The other criteria, which I can't discern from the product information, is that the Ab should be reactive with epitope(s) on the amino-terminal domain of this molecule, rather than the carboxyl terminus. Do you have this information and/or can you supply trial sizes of these or refund/replacement if unsuccessful?
- The immunogen of antibody H00007078-M01 was a partial recombinant protein comprising amino acids at the C-terminal end of TIMP3. The amino acid range of the immunogen for NBP1-67707 is amino acids 100-150 of human TIMP3, P35625. This antibody binds to the TIMP3 region that mediates interaction with EFEMP1.
Secondary Antibodies
| |
Isotype Controls
|
Additional TIMP-3 Products
Bioinformatics Tool for TIMP-3 Antibody (H00007078-M01)
Discover related pathways, diseases and genes to TIMP-3 Antibody (H00007078-M01). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TIMP-3 Antibody (H00007078-M01)
Discover more about diseases related to TIMP-3 Antibody (H00007078-M01).
| | Pathways for TIMP-3 Antibody (H00007078-M01)
View related products by pathway.
|
PTMs for TIMP-3 Antibody (H00007078-M01)
Learn more about PTMs related to TIMP-3 Antibody (H00007078-M01).
| | Research Areas for TIMP-3 Antibody (H00007078-M01)
Find related products by research area.
|
Blogs on TIMP-3