TIMP-3 Antibody (1D8)

Images

 
Sandwich ELISA: TIMP-3 Antibody (1D8) [H00007078-M01] - Detection limit for recombinant GST tagged TIMP3 is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA, S-ELISA
Clone
1D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIMP-3 Antibody (1D8) Summary

Immunogen
TIMP3 (AAH14277, 112 a.a. ~ 211 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINATDP
Specificity
TIMP3 - TIMP metallopeptidase inhibitor 3 (Sorsby fundus dystrophy, pseudoinflammatory) (1D8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TIMP3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
Application Notes
It has been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIMP-3 Antibody (1D8)

  • HSMRK222
  • K222
  • K222TA2
  • metalloproteinase inhibitor 3
  • MIG-5 protein
  • Protein MIG-5
  • pseudoinflammatory)
  • SFD
  • TIMP metallopeptidase inhibitor 3
  • TIMP3
  • TIMP-3
  • tissue inhibitor of metalloproteinase 3 (Sorsby fundus dystrophy
  • Tissue inhibitor of metalloproteinases 3

Background

This gene belongs to the TIMP gene family. The proteins encoded by this gene family are inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix (ECM). Expression of this gene is induced in response to mitogenic stimulation and this netrin domain-containing protein is localized to the ECM. Mutations in this gene have been associated with the autosomal dominant disorder Sorsby's fundus dystrophy. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DTM100
Species: Hu
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DMP300
Species: Hu
Applications: ELISA
NBP2-67415
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
DTM400
Species: Hu
Applications: ELISA
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
930-ADB
Species: Hu
Applications: EnzAct
DM1300
Species: Hu
Applications: ELISA
NB100-168
Species: Hu, Mu(-)
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-03644
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-76835
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DMP100
Species: Hu
Applications: ELISA

Publications for TIMP-3 Antibody (H00007078-M01) (0)

There are no publications for TIMP-3 Antibody (H00007078-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMP-3 Antibody (H00007078-M01) (0)

There are no reviews for TIMP-3 Antibody (H00007078-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TIMP-3 Antibody (H00007078-M01). (Showing 1 - 1 of 1 FAQ).

  1. What I need is an antibody to human TIMP-3 that works in ELISA. It seems you offer 2 such products now, NBP1-67707 and H00007078-M01. The other criteria, which I can't discern from the product information, is that the Ab should be reactive with epitope(s) on the amino-terminal domain of this molecule, rather than the carboxyl terminus. Do you have this information and/or can you supply trial sizes of these or refund/replacement if unsuccessful?
    • The immunogen of antibody H00007078-M01 was a partial recombinant protein comprising amino acids at the C-terminal end of TIMP3. The amino acid range of the immunogen for NBP1-67707 is amino acids 100-150 of human TIMP3, P35625. This antibody binds to the TIMP3 region that mediates interaction with EFEMP1.

Secondary Antibodies

 

Isotype Controls

Additional TIMP-3 Products

Bioinformatics Tool for TIMP-3 Antibody (H00007078-M01)

Discover related pathways, diseases and genes to TIMP-3 Antibody (H00007078-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMP-3 Antibody (H00007078-M01)

Discover more about diseases related to TIMP-3 Antibody (H00007078-M01).
 

Pathways for TIMP-3 Antibody (H00007078-M01)

View related products by pathway.

PTMs for TIMP-3 Antibody (H00007078-M01)

Learn more about PTMs related to TIMP-3 Antibody (H00007078-M01).
 

Research Areas for TIMP-3 Antibody (H00007078-M01)

Find related products by research area.

Blogs on TIMP-3

There are no specific blogs for TIMP-3, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIMP-3 Antibody (1D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMP3
Entrez
Uniprot