TIMP-1 Recombinant Protein Antigen

Images

 
There are currently no images for TIMP-1 Protein (NBP2-38700PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIMP-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIMP1.

Source: E. coli

Amino Acid Sequence: WNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TIMP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38700.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIMP-1 Recombinant Protein Antigen

  • CLGI
  • Collagenase inhibitor
  • collagenase inhibitor)
  • EPATIMP-1
  • EPO
  • erythroid potentiating activity
  • Erythroid-potentiating activity
  • Fibroblast collagenase inhibitor
  • FLJ90373
  • HCI
  • metalloproteinase inhibitor 1
  • TIMP metallopeptidase inhibitor 1
  • TIMP1
  • TIMP-1
  • TIMPtissue inhibitor of metalloproteinase 1 (erythroid potentiating activity
  • Tissue inhibitor of metalloproteinases 1

Background

Tissue inhibitor of metalloproteinases 1 (TIMP1) and Tissue inhibitor of metalloproteinases 2 (TIMP 2) have similar properties, specifically in inhibiting enzymes of matrix metalloproteinase family, and are thought to be of great importance in the maintenance of connective tissue integrity. TIMP1 forms a complex of 1:1 stoichiometry with activated interstitial collagenases, activated stromelysin, active form of 72kDa Type IV collagenase (also known as MMP2 or gelatinase A), and latent and active forms 92kDa Type IV collagenase (also known as MMP0 or gelatinase B). TIMPs inhibit the proteolytic invasiveness of tumour cells and normal placental trophoblast cells. TIMP1 is produced in low (pg/ml) levels by most cell types. Treatment of cells with the phorbol ester TPA stimulates production of TIMP1 in some cell types, but the low protein levels produced often require concentration of cell culture media to visualize the bands by Western Blotting.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMP900
Species: Hu
Applications: ELISA
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
M6000B
Species: Mu
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
203-IL
Species: Hu
Applications: BA
DVE00
Species: Hu
Applications: ELISA
NBP1-19388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
255-SC
Species: Hu
Applications: BA
973-TM
Species: Hu
Applications: InhibAct
DM1300
Species: Hu
Applications: ELISA
MAB9181
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP2-38700PEP
Species: Hu
Applications: AC

Publications for TIMP-1 Protein (NBP2-38700PEP) (0)

There are no publications for TIMP-1 Protein (NBP2-38700PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMP-1 Protein (NBP2-38700PEP) (0)

There are no reviews for TIMP-1 Protein (NBP2-38700PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIMP-1 Protein (NBP2-38700PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIMP-1 Products

Research Areas for TIMP-1 Protein (NBP2-38700PEP)

Find related products by research area.

Blogs on TIMP-1

There are no specific blogs for TIMP-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIMP-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMP1