TIMM9 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: TIMM9 Antibody [NBP1-80679] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.

Immunohistochemistry-Paraffin: TIMM9 Antibody [NBP1-80679] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TIMM9 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR
• Marker: Mitochondrial Biogenesis Marker
• Predicted Species: Mouse (98%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIMM9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Reported IHC in scientific literature (PMID: 23172368).
• Control Peptide:

  TIMM9 Protein (NBP1-80679PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 23172368).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TIMM9 Antibody - BSA Free

• TIM9Amitochondrial import inner membrane translocase subunit Tim9
• TIM9TIMM9A
• translocase of inner mitochondrial membrane 9 (yeast) homolog
• translocase of inner mitochondrial membrane 9 homolog (yeast)

Background

Mitochondrial intermembrane chaperone that participates in the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. May also be required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TIMM9 Antibody (NBP1-80679)(3)

Publications using NBP1-80679

• Stranahan AM, Guo DH, Yamamoto M et al. Sex Differences in Adipose Tissue Distribution Determine Susceptibility to Neuroinflammation in Mice With Dietary Obesity Diabetes 2022-11-11 [PMID: 36367881]
• Blackwood CB, Mateu-BorrAs M, Sen-Kilic E Et al. Bordetella pertussis whole cell immunization protects against Pseudomonas aeruginosa infections NPJ Vaccines 2022-11-10 [PMID: 36357402] (WB, Mouse)
  
  Details:
  Citation using the HRP version of this antibody.
• Sotgia F, Whitaker-Menezes D, Martinez-Outschoorn UE et al. Mitochondria fuel breast cancer metabolism: Fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells. Cell Cycle 2012-12-01 [PMID: 23172368] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: TIMM9
• Entrez:
  • 26520(Human)