TIMM50 Recombinant Protein Antigen

Images

 
There are currently no images for TIMM50 Protein (NBP2-38791PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TIMM50 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TIMM50.

Source: E. coli

Amino Acid Sequence: TGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDPHGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TIMM50
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38791.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TIMM50 Recombinant Protein Antigen

  • homolog of yeast Tim50
  • MGC102733
  • mitochondrial import inner membrane translocase subunit TIM50
  • TIM50
  • TIM50L
  • Tim50-like protein
  • translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
  • translocase of inner mitochondrial membrane 50 homolog (yeast)

Background

Tim50 is a component of the yeast Tim23 import machinery, which mediates translocation of presequence containing proteins across the mitochondrial inner membrane. By searching sequence databases, open reading frames encoding proteins with similarity to Tim50 and with a putative mitochondrial presequence were identified in the genomes of evolutionarily distant organisms, including human. Tim50 was found to interact with the N terminal intermembrane space domain of Tim23. Functional defects of Tim50 either by depletion of the protein or addition of anti Tim50 antibodies blocked the protein translocation across the inner membrane. A translocation intermediate accumulated at the translocator of the outer mitochondrial membrane (TOM) complex was cross linked to Tim50. Thus it can be concluded that Tim50, in cooperation with Tim23, facilitates transfer of the translocating protein from the TOM complex to the Tim23 complex.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00010431-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-80681
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-92298
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-80671
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP2-38289
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-86941
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP3-33021
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB500-487
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-87346
Species: Hu
Applications: IHC,  IHC-P
NBP3-09392
Species: Hu, Mu
Applications: WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
DYC2510-2
Species: Hu, Mu, Rt
Applications: ELISA
NBP1-76729
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-76798
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KO, WB
NBP1-83280
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, KD, WB
NBP2-93133
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-38791PEP
Species: Hu
Applications: AC

Publications for TIMM50 Protein (NBP2-38791PEP) (0)

There are no publications for TIMM50 Protein (NBP2-38791PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM50 Protein (NBP2-38791PEP) (0)

There are no reviews for TIMM50 Protein (NBP2-38791PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TIMM50 Protein (NBP2-38791PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TIMM50 Products

Research Areas for TIMM50 Protein (NBP2-38791PEP)

Find related products by research area.

Blogs on TIMM50

There are no specific blogs for TIMM50, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TIMM50 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TIMM50