TIMM44 Antibody


Western Blot: TIMM44 Antibody [NBP1-54381] - Titration: 0.2-1 ug/ml, Positive Control: OVCAR-3 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TIMM44 Antibody Summary

Synthetic peptides corresponding to TIMM44(translocase of inner mitochondrial membrane 44 homolog (yeast)) The peptide sequence was selected from the N terminal of TIMM44. Peptide sequence MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKS
This product is specific to Subunit or Isoform: TIM44.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TIMM44 and was validated on Western blot.
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TIMM44 Antibody

  • MIMT44
  • mitochondrial import inner membrane translocase subunit TIM44
  • mitochondrial inner membrane translocase
  • TIM44DKFZp686H05241
  • translocase of inner mitochondrial membrane 44 homolog (yeast)


TIMM44 is the essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. It recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu
Applications: WB

Publications for TIMM44 Antibody (NBP1-54381) (0)

There are no publications for TIMM44 Antibody (NBP1-54381).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIMM44 Antibody (NBP1-54381) (0)

There are no reviews for TIMM44 Antibody (NBP1-54381). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TIMM44 Antibody (NBP1-54381) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TIMM44 Antibody (NBP1-54381)

Discover related pathways, diseases and genes to TIMM44 Antibody (NBP1-54381). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIMM44 Antibody (NBP1-54381)

Discover more about diseases related to TIMM44 Antibody (NBP1-54381).

Pathways for TIMM44 Antibody (NBP1-54381)

View related products by pathway.

Research Areas for TIMM44 Antibody (NBP1-54381)

Find related products by research area.

Blogs on TIMM44

There are no specific blogs for TIMM44, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TIMM44 Antibody and receive a gift card or discount.


Gene Symbol TIMM44