TIMM17B Antibody (7N3Z2)

Western Blot: TIMM17B Antibody (7N3Z2) [NBP3-33481] - Western Blot analysis of various lysates using TIMM17B Rabbit mAb at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 7N3Z2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TIMM17B Antibody (7N3Z2) Summary

• Description: Novus Biologicals Rabbit TIMM17B Antibody (7N3Z2) (NBP3-33481) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 60-160 of human TIMM17B (NP_005825.1).
  
  Sequence:
  PQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGT
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TIMM17B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TIMM17B Antibody (7N3Z2)

• inner mitochondrial membrane preprotein translocase
• JM3
• mitochondrial import inner membrane translocase subunit Tim17-B
• TIM17BDXS9822
• translocase of inner mitochondrial membrane 17 homolog B (yeast)

Background

The TIMM17B gene encodes a protein that is part of the mitochondrial transport TIMM23 complex. TIM translocase complexes facilitate the transport of mitochondrial proteins from the cytosol across the mitochondrial inner membrane and into the mitochondrion. Two a

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIMM17B