Tight Junction Protein 1 Recombinant Protein Antigen

Images

 
There are currently no images for Tight Junction Protein 1 Protein (NBP1-85047PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Tight Junction Protein 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TJP1.

Source: E. coli

Amino Acid Sequence: RKLYERSHKLRKNNHHLFTTTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHTSDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVRED

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TJP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85047.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Tight Junction Protein 1 Recombinant Protein Antigen

  • DKFZp686M05161
  • MGC133289
  • tight junction protein 1 (zona occludens 1)
  • Tight junction protein 1
  • tight junction protein ZO-1
  • TJP1
  • ZO1
  • ZO-1
  • zona occludens 1
  • Zona occludens protein 1
  • zonula occludens 1 protein
  • Zonula occludens protein 1

Background

Members of this family are involved in epithelial and endothelial intercellular junctions. They each contain at least one PSD95/Dlg/ZO-1 (PDZ) domain, a Src homology 3 (SH3) domain, and an enzymatically inactive guanylate kinase domain. PDZ domains are 90-amino acid protein-protein binding domains that recognize at least a 3-residue peptide motif in the COOH termini of their binding partners. PDZ domain-containing proteins, like ZO-1, typically act as scaffolding proteins that organize membrane receptors and cytosolic proteins into multimeric signaling complexes often at the sites of cell-cell contact. The effectiveness and stability of the epithelial barrier depends on a complex of proteins composing different intercellular junctions, which include tight junctions, adherens junctions, and desmosomes. ZO-1 is a peripheral membrane protein bound on the cytoplasmic surface of junctional contacts and is expressed in all tight junctions regardless of their properties. ZO-1 immunoprecipitates with its family member ZO-2. ZO-1 was shown to undergo tyrosine phosphorylation during tight junction formation and remodeling. Two different isoforms of ZO-1, alpha-minus and alpha-plus, have been described, which result from alternative splicing of an mRNA encoded by a single gene. The ZO-1 alpha-plus contains an 80 amino acids motif called alpha which is not present in ZO-1 alpha-minus. The alpha-containing isoform is found in most epithelial cell junctions. The short isoform (ZO-1 alpha-minus) is found both in endothelial cells and the highly specialized epithelial junctions of renal glomeruli and Sertoli cells of the seminiferous tubules. This difference in distribution provides molecular distinction among tight junctions.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
NBP1-87402
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, KD, WB
H00009076-M01
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NBP2-92405
Species: Hu, Mu, Rt
Applications: WB
NBP2-92846
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB300-556
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
MAB4219
Species: Hu
Applications: CyTOF-ready, Flow
DVE00
Species: Hu
Applications: ELISA
NBP1-86850
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP3-18555
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-49230
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-38696
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NBP1-85047PEP
Species: Hu
Applications: AC

Publications for Tight Junction Protein 1 Protein (NBP1-85047PEP) (0)

There are no publications for Tight Junction Protein 1 Protein (NBP1-85047PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tight Junction Protein 1 Protein (NBP1-85047PEP) (0)

There are no reviews for Tight Junction Protein 1 Protein (NBP1-85047PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Tight Junction Protein 1 Protein (NBP1-85047PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Tight Junction Protein 1 Products

Blogs on Tight Junction Protein 1.

Zonula Occludens (ZO) the Junction Scaffolding Proteins
The Zonula Occludens (ZO) proteins 1,2 and 3, also known as tight junction proteins, are peripheral proteins localizing at junctional sites(1). ZO proteins are known to be scaffolding proteins recruiting various types of proteins to the cytoplasmic...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Tight Junction Protein 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TJP1