TIGD7 Antibody - BSA Free

Western Blot: TIGD7 Antibody [NBP2-85916] - Host: Rabbit. Target Name: TIGD7. Sample Type: Hela Whole Cell lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TIGD7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TIGD7 Antibody - BSA Free (NBP2-85916) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TIGD7. Peptide sequence: LETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TIGD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TIGD7 Antibody - BSA Free

• tigger transposable element derived 7

Background

The protein encoded by the TIGD7 gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons inhumans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 andmariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function ofthis gene is not known. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIGD7