TIFAB Antibody (1R6B8)

Western Blot: TIFAB Antibody (1R6B8) [NBP3-33473] - Western blot analysis of lysates from wild type (WT) and 293T cells transfected with TIFAB using [KD Validated] TIFAB Rabbit mAb at 1:2000 dilution incubated overnight at 4℃.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS

Western Blot: TIFAB Antibody (1R6B8) [NBP3-33473] - Western Blot analysis of lysates from wild type (WT) and TIFAB knockdown (KD) MV-4-11 cells using [KD Validated] TIFAB Rabbit mAb at 1:2000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.WB samples for antibody validation are kindly provided by Dr. Feng Shao, NIBS

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1R6B8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TIFAB Antibody (1R6B8) Summary

• Description: Novus Biologicals Rabbit TIFAB Antibody (1R6B8) (NBP3-33473) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 62-161 of human TIFAB.1)
  
  Sequence:
  PYLEKGSALLAFCLKALSRKGCVWVNGLTLRYLEQVPLSTVNRVSFSGIQMLVRVEEGTSLEAFVCYFHVSPSPLIYRPEAEETDEWEGISQGQPPPGSG
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TIFAB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:1000 - 1:5000
• Theoretical MW: 18 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TIFAB Antibody (1R6B8)

• TIFA-Like Protein
• TIFA-Related Protein TIFAB
• TRAF-Interacting Protein With FHA Domain-Containing Protein B
• TRAF-Interacting Protein With Forkhead-Associated Domain, Family Member B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TIFAB