TIF1 gamma Antibody (6F4) Summary
Immunogen |
TRIM33 (NP_056990, 1006 a.a. ~ 1105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS |
Localization |
Nuclear |
Specificity |
TRIM33 - tripartite motif-containing 33 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
TRIM33 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500
- ELISA
- Immunocytochemistry/Immunofluorescence
|
Application Notes |
Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA. |
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TIF1 gamma Antibody (6F4)
Background
The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP, S-ELISA
Species: Mu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ELISA, ICC/IF
Publications for TIF1 gamma Antibody (H00051592-M02) (0)
There are no publications for TIF1 gamma Antibody (H00051592-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TIF1 gamma Antibody (H00051592-M02) (0)
There are no reviews for TIF1 gamma Antibody (H00051592-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TIF1 gamma Antibody (H00051592-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional TIF1 gamma Products
Bioinformatics Tool for TIF1 gamma Antibody (H00051592-M02)
Discover related pathways, diseases and genes to TIF1 gamma Antibody (H00051592-M02). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for TIF1 gamma Antibody (H00051592-M02)
Discover more about diseases related to TIF1 gamma Antibody (H00051592-M02).
| | Pathways for TIF1 gamma Antibody (H00051592-M02)
View related products by pathway.
|
PTMs for TIF1 gamma Antibody (H00051592-M02)
Learn more about PTMs related to TIF1 gamma Antibody (H00051592-M02).
|
Blogs on TIF1 gamma