TIF1 gamma Antibody (6F4)

Images

 
Western Blot: TIF1 gamma Antibody (6F4) [H00051592-M02] - TRIM33 monoclonal antibody (M02), clone 6F4 Analysis of TRIM33 expression in Hela S3 NE.
Immunocytochemistry/ Immunofluorescence: TIF1 gamma Antibody (6F4) [H00051592-M02] - Analysis of monoclonal antibody to TRIM33 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
6F4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIF1 gamma Antibody (6F4) Summary

Immunogen
TRIM33 (NP_056990, 1006 a.a. ~ 1106 a.a) partial recombinant protein with GST tag.VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQV YADTQEINLKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPL PEFEQEEDDGEVTEDS
Localization
Nuclear
Specificity
TRIM33 - tripartite motif-containing 33
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM33
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody reactive against cell lysate for Western Blot. Has also been used for immunofluoresence and ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIF1 gamma Antibody (6F4)

  • E3 ubiquitin-protein ligase TRIM33
  • EC 6.3.2
  • EC 6.3.2.-
  • Ectodermin homolog
  • KIAA1113
  • Protein Rfg7
  • PTC7FLJ32925
  • RET-fused gene 7 protein
  • RFG7FLJ11429
  • TF1G
  • TIF1GAMMA
  • TIF1-gamma
  • TIF1GECTO
  • TIFGAMMA
  • Transcription intermediary factor 1-gamma
  • transcriptional intermediary factor 1 gamma
  • tripartite motif containing 33
  • tripartite motif-containing 33
  • Tripartite motif-containing protein 33

Background

The protein encoded by this gene is thought to be a transcriptional corepressor. However, molecules that interact with this protein have not yet been identified. The protein is a member of the tripartite motif family. This motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. Three alternatively spliced transcript variants for this gene have been described, however, the full-length nature of one variant has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
H00008031-M04
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-47945
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-32162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF482
Species: Mu
Applications: WB, IHC
NBP1-48321
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF1440
Species: Mu
Applications: WB
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2527
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
H00051592-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for TIF1 gamma Antibody (H00051592-M02) (0)

There are no publications for TIF1 gamma Antibody (H00051592-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIF1 gamma Antibody (H00051592-M02) (0)

There are no reviews for TIF1 gamma Antibody (H00051592-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIF1 gamma Antibody (H00051592-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIF1 gamma Products

Bioinformatics Tool for TIF1 gamma Antibody (H00051592-M02)

Discover related pathways, diseases and genes to TIF1 gamma Antibody (H00051592-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIF1 gamma Antibody (H00051592-M02)

Discover more about diseases related to TIF1 gamma Antibody (H00051592-M02).
 

Pathways for TIF1 gamma Antibody (H00051592-M02)

View related products by pathway.

PTMs for TIF1 gamma Antibody (H00051592-M02)

Learn more about PTMs related to TIF1 gamma Antibody (H00051592-M02).

Blogs on TIF1 gamma

There are no specific blogs for TIF1 gamma, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIF1 gamma Antibody (6F4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM33
Entrez
OMIM
Uniprot