TIAL1 Antibody

Images

 
Western Blot: TIAL1 Antibody [H00007073-B01P] - Analysis of TIAL1 expression in transfected 293T cell line by TIAL1 polyclonal antibody. Lane 1: TIAL1 transfected lysate(27.72 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: TIAL1 Antibody [H00007073-B01P] - Analysis of purified antibody to TIAL1 on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TIAL1 Antibody Summary

Immunogen
TIAL1 (AAH30025.1, 1 a.a. - 252 a.a.) full-length human protein. MDARVVKDMATGKSKGYGFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCGGIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TIAL1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TIAL1 Antibody

  • aging-associated gene 7 protein
  • MGC33401
  • TCBP
  • T-cluster binding protein
  • TIA1 cytotoxic granule-associated RNA binding protein-like 1
  • TIA1 cytotoxic granule-associated RNA-binding protein-like 1
  • TIA-1 related protein
  • TIA-1-related nucleolysin
  • TIA-1-related protein
  • TIARnucleolysin TIAR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46132
Species: Hu
Applications: WB, IHC, IHC-P
H00001994-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-02105
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88915
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-86274
Species: Hu
Applications: WB, IHC, IHC-P, INHIB T-cell
AF4245
Species: Hu
Applications: WB, IP
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-57100
Species: Hu
Applications: ICC/IF
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
H00007073-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for TIAL1 Antibody (H00007073-B01P) (0)

There are no publications for TIAL1 Antibody (H00007073-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TIAL1 Antibody (H00007073-B01P) (0)

There are no reviews for TIAL1 Antibody (H00007073-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TIAL1 Antibody (H00007073-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TIAL1 Products

Bioinformatics Tool for TIAL1 Antibody (H00007073-B01P)

Discover related pathways, diseases and genes to TIAL1 Antibody (H00007073-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TIAL1 Antibody (H00007073-B01P)

Discover more about diseases related to TIAL1 Antibody (H00007073-B01P).
 

Pathways for TIAL1 Antibody (H00007073-B01P)

View related products by pathway.

PTMs for TIAL1 Antibody (H00007073-B01P)

Learn more about PTMs related to TIAL1 Antibody (H00007073-B01P).
 

Research Areas for TIAL1 Antibody (H00007073-B01P)

Find related products by research area.

Blogs on TIAL1

There are no specific blogs for TIAL1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TIAL1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TIAL1
Uniprot