We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Thyroid receptor-interacting protein 13 Recombinant Protein Antigen

Images

 
There are currently no images for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Thyroid receptor-interacting protein 13 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRIP13.

Source: E. coli

Amino Acid Sequence: STAKKEDINLSVRKLLNRHNIVFGDYTWTEFDEPFLTRNVQSVSIIDTELKVKDSQPIDLSACTVALHIFQLNEDGPSSENLEEETENIIAANHWVLPAAEFHGLWDSLVYDVEVKSH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRIP13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90335.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thyroid receptor-interacting protein 13 Recombinant Protein Antigen

  • 16E1BP
  • 16E1-BP
  • HPV16 E1 protein binding protein
  • Human papillomavirus type 16 E1 protein-binding protein
  • thyroid hormone receptor interactor 13HPV16 E1 protein-binding protein
  • thyroid receptor interacting protein 13
  • thyroid receptor-interacting protein 13
  • TR-interacting protein 13
  • TRIP-13

Background

The Thyroid receptor-interacting protein 13 gene encodes a protein that interacts with thyroid hormone receptors, also known as hormone-dependent transcription factors. The gene product interacts specifically with the ligand binding domain. This gene is one of several that may play a role in e

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-30377
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-181
Species: Hu, Mu
Applications: IP, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NBP2-31923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-02667
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-76498
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-04564
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-1923
Species: Ce
Applications: IHC,  IHC-P, IP, WB
MAB5835
Species: Hu
Applications: ICC, IHC, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP1-58172
Species: Hu, Mu
Applications: WB
NBP1-85401
Species: Hu
Applications: IHC,  IHC-P
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
NB100-79810
Species: Hu, Mu
Applications: ICC/IF, IP, WB
NBP2-03688
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-2595
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-82724
Species: Hu
Applications: IHC,  IHC-P, WB

Publications for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP) (0)

There are no publications for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP) (0)

There are no reviews for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thyroid receptor-interacting protein 13 Products

Research Areas for Thyroid receptor-interacting protein 13 Protein (NBP1-90335PEP)

Find related products by research area.

Blogs on Thyroid receptor-interacting protein 13

There are no specific blogs for Thyroid receptor-interacting protein 13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thyroid receptor-interacting protein 13 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIP13