Thymosin beta 4 Antibody

Images

 
Western Blot: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of TMSB4X expression in transfected 293T cell line by TMSB4X polyclonal antibody. Lane 1: TMSB4X transfected lysate(4.84 KDa). Lane 2: Non-transfected ...read more
Immunocytochemistry/ Immunofluorescence: Thymosin beta 4 Antibody [H00007114-B01P] - Analysis of purified antibody to TMSB4X on HeLa cell. (antibody concentration 10 ug/ml)

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Thymosin beta 4 Antibody Summary

Immunogen
TMSB4X (AAH01631.1, 1 a.a. - 44 a.a.) full-length human protein. MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Specificity
TMSB4X - thymosin, beta 4, X-linked,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TMSB4X
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.
Control
Thymosin beta 4 Knockout 293T Cell Lysate
Publications
Read Publication using H00007114-B01P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Thymosin beta 4 Antibody

  • PTMB4
  • T beta-4
  • TB4
  • TB4X
  • TB4Xbeta 4, X chromosome
  • THYB4
  • Thymosin beta 4
  • thymosin beta 4, X-linked
  • thymosin beta-4
  • TMSB4
  • TMSB4X

Background

This gene encodes an actin sequestering protein which plays a role in regulation of actin polymerization. The protein is also involved in cell proliferation, migration, and differentiation. This gene escapes X inactivation and has a homolog on chromosome Y. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
DTFP10
Species: Hu
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu, Mu, Ca, Fe
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Dual ISH-IHC
NB100-2564
Species: Hu
Applications: WB
NBP2-59478
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-76966
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89985
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
H00007114-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Thymosin beta 4 Antibody (H00007114-B01P)(1)

Reviews for Thymosin beta 4 Antibody (H00007114-B01P) (0)

There are no reviews for Thymosin beta 4 Antibody (H00007114-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Thymosin beta 4 Antibody (H00007114-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Thymosin beta 4 Products

Bioinformatics Tool for Thymosin beta 4 Antibody (H00007114-B01P)

Discover related pathways, diseases and genes to Thymosin beta 4 Antibody (H00007114-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thymosin beta 4 Antibody (H00007114-B01P)

Discover more about diseases related to Thymosin beta 4 Antibody (H00007114-B01P).
 

Pathways for Thymosin beta 4 Antibody (H00007114-B01P)

View related products by pathway.

Blogs on Thymosin beta 4

There are no specific blogs for Thymosin beta 4, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thymosin beta 4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMSB4X
Entrez
Uniprot