Thymosin beta 10 Antibody (2E3)

Images

 
Sandwich ELISA: Thymosin beta 10 Antibody (2E3) [H00009168-M02] - Detection limit for recombinant GST tagged TMSB10 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Thymosin beta 10 Antibody (2E3) Summary

Immunogen
TMSB10 (AAH16025, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS
Specificity
TMSB10 - thymosin, beta 10 (2E3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TMSB10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Thymosin beta 10 Antibody (2E3)

  • MIG12
  • migration-inducing gene 12
  • migration-inducing protein 12
  • PTMB10
  • TB10
  • THYB10
  • Thymosin beta 10
  • thymosin beta-10
  • TMSB10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
DVE00
Species: Hu
Applications: ELISA
202-IL
Species: Hu
Applications: BA
DY417
Species: Mu
Applications: ELISA
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
AF6796
Species: Hu
Applications: ICC, Simple Western, WB
NBP2-00955
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89366
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
NBP3-10377
Species: Hu
Applications: WB
NBP1-89163
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
207-IL/CF
Species: Hu
Applications: BA

Publications for Thymosin beta 10 Antibody (H00009168-M02) (0)

There are no publications for Thymosin beta 10 Antibody (H00009168-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymosin beta 10 Antibody (H00009168-M02) (0)

There are no reviews for Thymosin beta 10 Antibody (H00009168-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thymosin beta 10 Antibody (H00009168-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thymosin beta 10 Products

Bioinformatics Tool for Thymosin beta 10 Antibody (H00009168-M02)

Discover related pathways, diseases and genes to Thymosin beta 10 Antibody (H00009168-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thymosin beta 10 Antibody (H00009168-M02)

Discover more about diseases related to Thymosin beta 10 Antibody (H00009168-M02).
 

Pathways for Thymosin beta 10 Antibody (H00009168-M02)

View related products by pathway.

PTMs for Thymosin beta 10 Antibody (H00009168-M02)

Learn more about PTMs related to Thymosin beta 10 Antibody (H00009168-M02).

Blogs on Thymosin beta 10

There are no specific blogs for Thymosin beta 10, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thymosin beta 10 Antibody (2E3) and receive a gift card or discount.

Bioinformatics

Gene Symbol TMSB10
Entrez
Uniprot