Thymosin beta 10 Antibody (2E3) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Thymosin beta 10 Antibody (2E3) - Azide and BSA Free (H00009168-M02) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
TMSB10 (AAH16025, 1 a.a. ~ 44 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS |
| Specificity |
TMSB10 - thymosin, beta 10 (2E3) |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TMSB10 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Thymosin beta 10 Antibody (2E3) - Azide and BSA Free
Background
Thymosin beta 10 plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: BA
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Mu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Publications for Thymosin beta 10 Antibody (H00009168-M02) (0)
There are no publications for Thymosin beta 10 Antibody (H00009168-M02).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thymosin beta 10 Antibody (H00009168-M02) (0)
There are no reviews for Thymosin beta 10 Antibody (H00009168-M02).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Thymosin beta 10 Antibody (H00009168-M02) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Thymosin beta 10 Products
Blogs on Thymosin beta 10