Thymosin alpha 1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Thymosin alpha 1. Source: E. coli Amino Acid Sequence: RTERADRWPGAARRTAAEGFPQARTPDLCWYWWPCRVEKVTGRPGPRCLLDPGRSPTPEDLKEK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
PTMA |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55714. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
25 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Thymosin alpha 1 Recombinant Protein Antigen
Background
Thymosin alpha 1 is a protein that helps mediate immune function by conferring resistance to various infections, and has two isoforms, with lengths of 111 and 110 amino acids and both weighing approximately 12 kDa. Current studies are being done on several diseases and disorders related to this protein including severe acute respiratory syndrome, myasthenia gravis, chronic obstructive pulmonary disease, hepatitis, liver cirrhosis, male infertility, thymoma, pituitary adenoma, hepatocellular carcinoma, hepatoblastoma, sepsis, tonsillitis, gastric adenocarcinoma, and breast cancer. Thymosin alpha 1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the C-MYC transcriptional activation pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IP, Neut, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Publications for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP) (0)
There are no publications for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP) (0)
There are no reviews for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP) (0)
Additional Thymosin alpha 1 Products
Research Areas for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP)
Find related products by research area.
|
Blogs on Thymosin alpha 1