Thymosin alpha 1 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related Thymosin alpha 1 Peptides and Proteins

Order Details


    • Catalog Number
      NBP2-55714PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Thymosin alpha 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Thymosin alpha 1.

Source: E. coli

Amino Acid Sequence: RTERADRWPGAARRTAAEGFPQARTPDLCWYWWPCRVEKVTGRPGPRCLLDPGRSPTPEDLKEK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PTMA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55714.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thymosin alpha 1 Recombinant Protein Antigen

  • alpha (gene sequence 28)
  • gene sequence 28
  • MGC104802
  • prothymosin alpha protein
  • prothymosin alpha
  • prothymosin, alpha
  • PTMA prothymosin, alpha
  • TMSA

Background

Thymosin alpha 1 is a protein that helps mediate immune function by conferring resistance to various infections, and has two isoforms, with lengths of 111 and 110 amino acids and both weighing approximately 12 kDa. Current studies are being done on several diseases and disorders related to this protein including severe acute respiratory syndrome, myasthenia gravis, chronic obstructive pulmonary disease, hepatitis, liver cirrhosis, male infertility, thymoma, pituitary adenoma, hepatocellular carcinoma, hepatoblastoma, sepsis, tonsillitis, gastric adenocarcinoma, and breast cancer. Thymosin alpha 1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the C-MYC transcriptional activation pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
202-IL
Species: Hu
Applications: BA
H00005763-M10
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-32822
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-09949
Species: Hu
Applications: WB
NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
AF2460
Species: Hu
Applications: IP, Neut, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB3024
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB2676
Species: Hu, Mu, Rt
Applications: ICC, WB

Publications for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP) (0)

There are no publications for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP) (0)

There are no reviews for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thymosin alpha 1 Products

Research Areas for Thymosin alpha 1 Recombinant Protein Antigen (NBP2-55714PEP)

Find related products by research area.

Blogs on Thymosin alpha 1

There are no specific blogs for Thymosin alpha 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thymosin alpha 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PTMA