PTMS Antibody (2D3)

Images

 
Western Blot: PTMS Antibody (2D3) [H00005763-M10] - Analysis of PTMS expression in transfected 293T cell line by PTMS monoclonal antibody (M10), clone 2D3. Lane 1: PTMS transfected lysate (Predicted MW: 11.5 KDa). Lane ...read more
Immunohistochemistry-Paraffin: PTMS Antibody (2D3) [H00005763-M10] - Analysis of monoclonal antibody to PTMS on formalin-fixed paraffin-embedded human placenta. Antibody concentration 1.5 ug/ml
Sandwich ELISA: PTMS Antibody (2D3) [H00005763-M10] - Detection limit for recombinant GST tagged PTMS is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
2D3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

PTMS Antibody (2D3) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
PTMS (AAH17025, 1 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSEKSVEAAAELSAKDLKEKKEKVEEKASRKERKKEVVEEEENGAEEEEEETAEDGEEEDEGEEEDEEEEEEDDEGPALKRAAEEEDEADPKRQKTENGASA
Specificity
PTMS - parathymosin (2D3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PTMS
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PTMS Antibody (2D3)

  • ParaT
  • parathymosin

Background

Parathymosin may mediate immune function by blocking the effect of prothymosin alpha which confers resistance to certain opportunistic infections

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PTMS Antibody (H00005763-M10) (0)

There are no publications for PTMS Antibody (H00005763-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PTMS Antibody (H00005763-M10) (0)

There are no reviews for PTMS Antibody (H00005763-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PTMS Antibody (H00005763-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PTMS Products

Research Areas for PTMS Antibody (H00005763-M10)

Find related products by research area.

Blogs on PTMS

There are no specific blogs for PTMS, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PTMS Antibody (2D3) and receive a gift card or discount.

Bioinformatics

Gene Symbol PTMS
Entrez
Uniprot