Thymosin alpha 1 Antibody Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTERADRWPGAARRTAAEGFPQARTPDLCWYWWPCRVEKVTGRPGPRCLLDPGRSPTPEDLKEK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
PTMA |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Thymosin alpha 1 Antibody
Background
Thymosin alpha 1 is a protein that helps mediate immune function by conferring resistance to various infections, and has two isoforms, with lengths of 111 and 110 amino acids and both weighing approximately 12 kDa. Current studies are being done on several diseases and disorders related to this protein including severe acute respiratory syndrome, myasthenia gravis, chronic obstructive pulmonary disease, hepatitis, liver cirrhosis, male infertility, thymoma, pituitary adenoma, hepatocellular carcinoma, hepatoblastoma, sepsis, tonsillitis, gastric adenocarcinoma, and breast cancer. Thymosin alpha 1 has also been shown to have interactions with HIST1H4A, HIST1H4B, HIST1H4C, HIST1H4D, and HIST1H4E in pathways such as the C-MYC transcriptional activation pathway.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: IP, Neut, WB
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: KO, Simple Western, WB
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Publications for Thymosin alpha 1 Antibody (NBP2-55714) (0)
There are no publications for Thymosin alpha 1 Antibody (NBP2-55714).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thymosin alpha 1 Antibody (NBP2-55714) (0)
There are no reviews for Thymosin alpha 1 Antibody (NBP2-55714).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Thymosin alpha 1 Antibody (NBP2-55714) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Thymosin alpha 1 Products
Research Areas for Thymosin alpha 1 Antibody (NBP2-55714)
Find related products by research area.
|
Blogs on Thymosin alpha 1