We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

TOX Recombinant Protein Antigen

Images

 
There are currently no images for TOX Recombinant Protein Antigen (NBP1-87857PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOX Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOX.

Source: E. coli

Amino Acid Sequence: PDAPCLGPSPCLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITPPSLPDHSLVHLNEVESGYHSLCHPMNHNGLLPFHPQN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOX
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87857.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOX Recombinant Protein Antigen

  • KIAA0808
  • KIAA0808TOX1
  • thymocyte selection-associated high mobility group box protein TOX
  • thymocyte selection-associated high mobility group box
  • Thymus high mobility group box protein TOX
  • TOX
  • TOX1

Background

The protein encoded by the thymocyte selection-associated high mobility group box gene contains a HMG box DNA binding domain. HMG boxes are found in many eukaryotic proteins involved in chromatin assembly, transcription and replication. This protein may function to regulate T-cell development.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32398
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
NBP1-88691
Species: Hu
Applications: IHC,  IHC-P, WB
NBL1-15344
Species: Hu
Applications: WB
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-46005
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, PLA, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-83997
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88027
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, Simple Western, WB
NBP1-90906
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-16679
Species: Dr, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-91942
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-2596
Species: Hu, Mu
Applications: CHIP-SEQ, IHC,  IHC-P, IP, WB
NBP2-84249
Species: Mu
Applications: IHC,  IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP3-26842
Species: Hu
Applications: ICC/IF
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NBP2-67667
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-87857PEP
Species: Hu
Applications: AC

Publications for TOX Recombinant Protein Antigen (NBP1-87857PEP) (0)

There are no publications for TOX Recombinant Protein Antigen (NBP1-87857PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOX Recombinant Protein Antigen (NBP1-87857PEP) (0)

There are no reviews for TOX Recombinant Protein Antigen (NBP1-87857PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOX Recombinant Protein Antigen (NBP1-87857PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOX Products

Array NBP1-87857PEP

Research Areas for TOX Recombinant Protein Antigen (NBP1-87857PEP)

Find related products by research area.

Blogs on TOX

There are no specific blogs for TOX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOX Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOX