Thymidylate Synthase Antibody

Images

 
Western Blot: Thymidylate Synthase Antibody [H00007298-D01P] - Analysis of TYMS expression in transfected 293T cell line by TYMS polyclonal antibody.Lane 1: TYMS transfected lysate(35.70 KDa).Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Thymidylate Synthase Antibody Summary

Immunogen
TYMS (AAH13919.1, 1 a.a. - 313 a.a.) full-length human protein. MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV
Specificity
TYMS - thymidylate synthetase,
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TYMS
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Thymidylate Synthase Antibody

  • EC 2.1.1.45
  • HsT422
  • MGC88736
  • thymidylate synthase
  • thymidylate synthetase
  • TMSTsase
  • TSase
  • TSHST422

Background

Thymidylate synthase catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs. Expression of this gene and that of a naturally occuring antisense transcript rTSalpha (GeneID:55556) vary inversely when cell-growth progresses from late-log to plateau phase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
H00001719-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45397
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-85896
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-28872
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87822
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-48965
Species: Hu
Applications: IHC
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-87741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Thymidylate Synthase Antibody (H00007298-D01P) (0)

There are no publications for Thymidylate Synthase Antibody (H00007298-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymidylate Synthase Antibody (H00007298-D01P) (0)

There are no reviews for Thymidylate Synthase Antibody (H00007298-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Thymidylate Synthase Antibody (H00007298-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Thymidylate Synthase Products

Bioinformatics Tool for Thymidylate Synthase Antibody (H00007298-D01P)

Discover related pathways, diseases and genes to Thymidylate Synthase Antibody (H00007298-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Thymidylate Synthase Antibody (H00007298-D01P)

Discover more about diseases related to Thymidylate Synthase Antibody (H00007298-D01P).
 

Pathways for Thymidylate Synthase Antibody (H00007298-D01P)

View related products by pathway.

PTMs for Thymidylate Synthase Antibody (H00007298-D01P)

Learn more about PTMs related to Thymidylate Synthase Antibody (H00007298-D01P).
 

Research Areas for Thymidylate Synthase Antibody (H00007298-D01P)

Find related products by research area.

Blogs on Thymidylate Synthase

There are no specific blogs for Thymidylate Synthase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Thymidylate Synthase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TYMS
Entrez
Uniprot