Thymidine Kinase 2 Recombinant Protein Antigen

Images

 
There are currently no images for Thymidine Kinase 2 Protein (NBP1-92505PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Thymidine Kinase 2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TK2.

Source: E. coli

Amino Acid Sequence: YVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TK2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92505. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Thymidine Kinase 2 Recombinant Protein Antigen

  • EC 2.7.1.21
  • MTDPS2
  • MTTK
  • mt-TK
  • thymidine kinase 2, mitochondrial

Background

The mitochondrial deoxyribonucleotide (dNTP) pool is separated from the cytosolic pool because the mitochondria inner membrane is impermeable to charged molecules. The mitochondrial pool is maintained by either import of cytosolic dNTPs through dedicated transporters or by salvaging deoxynucleosides within the mitochondria; apparently, enzymes of the de novo dNTP synthesis pathway are not present in the mitochondria. In nonreplicating cells, where cytosolic dNTP synthesis is downregulated, mtDNA synthesis depends solely on the mitochondrial salvage pathway enzymes, the deoxyribonucleoside kinases. Two of the 4 human deoxyribonucleoside kinases, deoxyguanosine kinase (DGK) and thymidine kinase-2, are expressed in mitochondria. Human DGK, encoded by the DGUOK gene (MIM 601465), efficiently phosphorylates deoxyguanosine and deoxyadenosine, whereas TK2 phosphorylates deoxythymidine, deoxycytidine, and deoxyuridine. Thymidine kinase-2 (TK2) is a deoxyribonucleoside kinase that phosphorylates thymidine, deoxycytidine, and deoxyuridine, and also phosphorylates antiviral and anticancer nucleoside analogs.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NBP1-84256
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-16108
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-20626
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NBP1-52300
Species: Hu, Mu
Applications: ICC, ICC/IF, IHC, IHC-P, WB
MAB6727
Species: Hu
Applications: WB
MAB5125
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87441
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP1-32695
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-26326
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-87769
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00171023-M05
Species: Hu
Applications: ELISA, IP, WB
NB100-2737
Species: Hu
Applications: ICC/IF, IHC, IP, WB
NBP1-33015
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, Simple Western, WB
NBP1-76781
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-47058
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
NBP1-89489
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-92505PEP
Species: Hu
Applications: AC

Publications for Thymidine Kinase 2 Protein (NBP1-92505PEP) (0)

There are no publications for Thymidine Kinase 2 Protein (NBP1-92505PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Thymidine Kinase 2 Protein (NBP1-92505PEP) (0)

There are no reviews for Thymidine Kinase 2 Protein (NBP1-92505PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Thymidine Kinase 2 Protein (NBP1-92505PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Thymidine Kinase 2 Products

Blogs on Thymidine Kinase 2

There are no specific blogs for Thymidine Kinase 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Thymidine Kinase 2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TK2