Recombinant Human Thrombopoietin/THPO Protein Summary
Description |
THPO (Human) Recombinant Protein
Source: E. coli
Amino Acid Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNEL |
Preparation Method |
Escherichia coli expression system |
Details of Functionality |
The activity is determined by the dose-dependent stimulation of MO7e cells and is typically less than 1 ng/mL. |
Protein/Peptide Type |
Recombinant Protein |
Gene |
THPO |
Applications/Dilutions
Dilutions |
|
Application Notes |
This product is useful for Func,SDS-PAGE. |
Reactivity Notes
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
Lyophilized from 10 mM Na2PO4, pH 8.0 |
Preservative |
No Preservative |
Reconstitution Instructions |
Reconstitute with sterilized water to desired concentration. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Thrombopoietin/THPO Protein
Background
Thrombopoietin is a humoral growth factor that is necessary for megakaryocyte proliferation and maturation, as well as for thrombopoiesis. This protein is the ligand for MLP/cMPL, the product of myeloproliferative leukemia virus oncogene. Alternatively spliced transcript variants encoding distinct isoforms have been reported.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: Neut, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Rt
Applications: IHC, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Publications for Thrombopoietin/THPO Recombinant Protein (P4373) (0)
There are no publications for Thrombopoietin/THPO Recombinant Protein (P4373).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Thrombopoietin/THPO Recombinant Protein (P4373) (0)
There are no reviews for Thrombopoietin/THPO Recombinant Protein (P4373).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Thrombopoietin/THPO Recombinant Protein (P4373) (0)
Additional Thrombopoietin/THPO Products
Research Areas for Thrombopoietin/THPO Recombinant Protein (P4373)
Find related products by research area.
|
Blogs on Thrombopoietin/THPO