THRAP3 Recombinant Protein Antigen

Images

 
There are currently no images for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

THRAP3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human THRAP3.

Source: E. coli

Amino Acid Sequence: RGKRSEGGHRGFVPEKNFRVTAYKAVQEKSSSPPPRKTSESRDKLGAKGDFPTGKSSFSITREAQVNVRMDSFDEDLARPSGL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THRAP3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57174.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for THRAP3 Recombinant Protein Antigen

  • FLJ22082
  • MGC133082
  • MGC133083
  • thyroid hormone receptor associated protein 3
  • Thyroid hormone receptor-associated protein complex 150 kDa component
  • thyroid hormone receptor-associated protein, 150 kDa subunit
  • Trap150
  • TRAP150thyroid hormone receptor-associated protein 3

Background

Thyroid hormone receptors (TRs) are ligand dependent members of the steroid/retinoic acid superfamily of transcription factors. The two genes encoding TRs identified to date, TR alpha and TR beta, have been mapped to human chromosomes 17 and 3, respectively. TRs bind to thyroid hormone response elements (TREs) with half site binding motifs in the orientation of palindromes, direct repeats, or inverted palindromes. The affinities of binding are both variable and influenced differentially by 3,5,3 triiodo L thyronine (T3). Thyroid hormones, through their interaction with the thyroid receptor (TR), effect metabolic processes, growth and development in many tissues by regulating the expression of genes for growth hormone, malic enzyme and several hepatic proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2574
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
NBP2-24859
Species: Ca, Hu, Mu, Pm
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
AF3308
Species: Mu
Applications: WB
NBP2-92206
Species: Hu, Mu
Applications: ICC/IF, WB
DCDL40
Species: Hu
Applications: ELISA
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NBP1-87315
Species: Hu
Applications: IHC,  IHC-P
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-76350
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NBP1-59786
Species: Hu
Applications: WB
NB100-74360
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-2466
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-91189
Species: Hu, Mu(-)
Applications: ICC/IF, IHC,  IHC-P, WB (-)
NBP2-57174PEP
Species: Hu
Applications: AC

Publications for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP) (0)

There are no publications for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP) (0)

There are no reviews for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional THRAP3 Products

Research Areas for THRAP3 Recombinant Protein Antigen (NBP2-57174PEP)

Find related products by research area.

Blogs on THRAP3

There are no specific blogs for THRAP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our THRAP3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol THRAP3