Recombinant Human TFII-I Protein

Images

 
There are currently no images for TFII-I Recombinant Protein (H00002969-P01).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human TFII-I Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-239 of Human GTF2I full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG

Protein/Peptide Type
Recombinant Protein
Gene
GTF2I

Applications/Dilutions

Application Notes
Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TFII-I Protein

  • BAP-135,135kD
  • BAP135WBS
  • Bruton tyrosine kinase-associated protein 135
  • BTKAP1
  • DIWS
  • FLJ38776
  • FLJ56355
  • general transcription factor II, i
  • general transcription factor IIi
  • general transcription factor II-I
  • GTFII-I
  • IB291
  • SPINBTK-associated protein 135
  • TFII-ISRF-Phox1-interacting protein
  • WBSCR6
  • Williams-Beuren syndrome chromosome region 6

Background

This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91973
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2076
Species: Hu, Po, Ca, Fe, Gt, GP, Sh
Applications: WB, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP2-38290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-78295
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB110-89456
Species: Hu
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TFII-I Recombinant Protein (H00002969-P01) (0)

There are no publications for TFII-I Recombinant Protein (H00002969-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TFII-I Recombinant Protein (H00002969-P01) (0)

There are no reviews for TFII-I Recombinant Protein (H00002969-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TFII-I Recombinant Protein (H00002969-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TFII-I Products

Bioinformatics Tool for TFII-I Recombinant Protein (H00002969-P01)

Discover related pathways, diseases and genes to TFII-I Recombinant Protein (H00002969-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TFII-I Recombinant Protein (H00002969-P01)

Discover more about diseases related to TFII-I Recombinant Protein (H00002969-P01).
 

Pathways for TFII-I Recombinant Protein (H00002969-P01)

View related products by pathway.

PTMs for TFII-I Recombinant Protein (H00002969-P01)

Learn more about PTMs related to TFII-I Recombinant Protein (H00002969-P01).
 

Research Areas for TFII-I Recombinant Protein (H00002969-P01)

Find related products by research area.

Blogs on TFII-I

There are no specific blogs for TFII-I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

TFII-I Antibody
NBP1-90010

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TFII-I Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2I