TFF3 Antibody (3D9) - Azide and BSA Free

Immunohistochemistry-Paraffin: TFF3 Antibody (3D9) [H00007033-M01] - Analysis of monoclonal antibody to TFF3 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.

ELISA: TFF3 Antibody (3D9) [H00007033-M01] - Detection limit for recombinant GST tagged TFF3 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, IHC
• Clone: 3D9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TFF3 Antibody (3D9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TFF3 (AAH17859.1, 15 a.a. ~ 73 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
• Specificity: TFF3 - trefoil factor 3 (intestinal)
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TFF3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 3 ug/ml
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. Use in Immunohistochemistry reported in scientific literature (PMID: 22516806).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TFF3 Antibody (3D9) - Azide and BSA Free

• HITF, human intestinal trefoil factor10Intestinal trefoil factor
• ITF
• TFF3
• TFI
• trefoil factor 3 (intestinal)

Background

Members of the trefoil family are characterized by having at least one copy of the trefoil motif, a 40-amino acid domain that contains three conserved disulfides. They are stable secretory proteins expressed in gastrointestinal mucosa. Their functions are not defined, but they may protect the mucosa from insults, stabilize the mucus layer and affect healing of the epithelium. This gene is expressed in goblet cells of the intestines and colon. This gene and two other related trefoil family member genes are found in a cluster on chromosome 21.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TFF3 Antibody (H00007033-M01)(9)

Publications using H00007033-M01

• Du TY, Luo HM, Qin HC et al. Circulating serum trefoil factor 3 (TFF3) is dramatically increased in chronic kidney disease. PLoS One. 2013-01-01 [PMID: 24282531] (Human)
• Han G, Sidhu D, Duggan MA et al. Reproducibility of histological cell type in high-grade endometrial carcinoma. Mod Pathol. 2013-06-28 [PMID: 23807777]
• Casado E, Garcia VM, Sanchez JJ et al. Upregulation of Trefoil Factor 3 (TFF3) After Rectal Cancer Chemoradiotherapy Is an Adverse Prognostic Factor and a Potential Therapeutic Target. Int J Radiat Oncol Biol Phys. 2012-04-18 [PMID: 22516806] (IF/IHC, Human)
• Schulze U, Hampel U, Sel S et al. Fresh and cryopreserved amniotic membrane secrete the trefoil factor family peptide 3 that is well known to promote wound healing. Histochem Cell Biol. 2012-04-03 [PMID: 22476621]
• Kim HJ, Kang UB, Lee H et al. Profiling of differentially expressed proteins in stage IV Colorectal cancers with good and poor outcomes. J Proteomics. 2011-12-10 [PMID: 22178445]
• Proia TA, Keller PJ, Gupta PB et al. Genetic predisposition directs breast cancer phenotype by dictating progenitor cell fate. Cell Stem Cell. 2011-02-04 [PMID: 21295272]
• Kalloger S, Kobel M, Leung S et al. Calculator for ovarian carcinoma subtype prediction. Mod Pathol. 2010-12-03 [PMID: 21131918]
• Xue H, Lu B, Zhang J et al. Identification of serum biomarkers for colorectal cancer metastasis using a differential secretome approach. J Proteome Res 9(1):545-55. 2010-01-01 [PMID: 19924834]
• Bignotti E, Ravaggi A, Tassi RA et al. Trefoil factor 3: a novel serum marker identified by gene expression profiling in high-grade endometrial carcinomas. Br J Cancer. 2008-09-02 [PMID: 18682706]

Bioinformatics

• Gene Symbol: TFF3
• Entrez:
  • 7033(Human)
• OMIM:
  • 600633(Human)
• Uniprot:
  • AAH17859(Human)