TFB2M Antibody - BSA Free

Western Blot: TFB2M Antibody [NBP1-82114] - Analysis in control (vector only transfected HEK293T lysate) and TFB2M over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry: TFB2M Antibody [NBP1-82114] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TFB2M Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TFB2M Antibody - BSA Free (NBP1-82114) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: FKNLGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFB2M
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 45 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  TFB2M Protein (NBP1-82114PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TFB2M Antibody - BSA Free

• dimethyladenosine transferase 2, mitochondrial
• EC 2.1.1.-
• FLJ22661
• FLJ23182
• HCV NS5A-transactivated protein 5
• Hepatitis C virus NS5A-transactivated protein 5
• Hkp1
• h-mtTFB
• h-mtTFB2
• hTFB2M
• Mitochondrial 12S rRNA dimethylase 2
• Mitochondrial transcription factor B2
• mtTFB2
• NS5ATP5
• S-adenosylmethionine-6-N', N'-adenosyl(rRNA) dimethyltransferase 2
• transcription factor B2, mitochondrial

Background

S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA atthe conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction withPOLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity. Compared to TFB1M, itactivates transcription of mitochondrial DNA more efficiently, while it has less methyltransferase activity

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TFB2M
• Entrez:
  • 64216(Human)
• Uniprot:
  • Q9H5Q4(Human)