PPRC1 Antibody

Images

 
Western Blot: PPRC1 Antibody [NBP1-82985] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: PPRC1 Antibody [NBP1-82985] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: PPRC1 Antibody [NBP1-82985] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

PPRC1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPRC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
PPRC1 Protein (NBP1-82985PEP)

Alternate Names for PPRC1 Antibody

  • KIAA0595gamma, coactivator-related 1
  • peroxisome proliferator-activated receptor gamma, coactivator-related 1
  • PGC-1 related co-activator
  • PGC-1-related coactivator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6077
Species: Hu
Applications: WB
H00006277-M10
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB3429
Species: Hu
Applications: WB
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-39057
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82985
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for PPRC1 Antibody (NBP1-82985) (0)

There are no publications for PPRC1 Antibody (NBP1-82985).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPRC1 Antibody (NBP1-82985) (0)

There are no reviews for PPRC1 Antibody (NBP1-82985). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for PPRC1 Antibody (NBP1-82985) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPRC1 Antibody Products

Related Products by Gene

Bioinformatics Tool for PPRC1 Antibody (NBP1-82985)

Discover related pathways, diseases and genes to PPRC1 Antibody (NBP1-82985). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for PPRC1 Antibody (NBP1-82985)

Discover more about diseases related to PPRC1 Antibody (NBP1-82985).
 

Pathways for PPRC1 Antibody (NBP1-82985)

View related products by pathway.

Blogs on PPRC1

There are no specific blogs for PPRC1, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol PPRC1

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-82985 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought