mtRNA polymerase Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP1-90126] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry: mtRNA polymerase Antibody [NBP1-90126] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

mtRNA polymerase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLRMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
mtRNA polymerase Protein (NBP1-90126PEP)
Publications
Read Publications using
NBP1-90126 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23070475)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for mtRNA polymerase Antibody

  • APOLMTEC 2.7.7.6
  • DNA-directed RNA polymerase, mitochondrial
  • h-mtRPOL
  • MTRNAP
  • MTRPOL
  • polymerase (RNA) mitochondrial (DNA directed)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-82114
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13429
Species: Hu
Applications: WB, IHC, IHC-P
NB100-61070
Species: Hu
Applications: WB (-), IP
NBP2-20211
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-90814
Species: Hu
Applications: IHC, IHC-P
NBP1-84125
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92144
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37986
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82109
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00006182-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NB100-2269
Species: Hu, Mu
Applications: WB, IHC-P, IP
H00028299-P01
Species: Hu
NBP1-80720
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84754
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
H00055922-M06
Species: Hu
Applications: WB, ELISA
NBP2-33832
Species: Hu
Applications: IHC, IHC-P
NBP1-90126
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for mtRNA polymerase Antibody (NBP1-90126)(2)

Reviews for mtRNA polymerase Antibody (NBP1-90126) (0)

There are no reviews for mtRNA polymerase Antibody (NBP1-90126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for mtRNA polymerase Antibody (NBP1-90126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mtRNA polymerase Products

Bioinformatics Tool for mtRNA polymerase Antibody (NBP1-90126)

Discover related pathways, diseases and genes to mtRNA polymerase Antibody (NBP1-90126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mtRNA polymerase Antibody (NBP1-90126)

Discover more about diseases related to mtRNA polymerase Antibody (NBP1-90126).
 

Pathways for mtRNA polymerase Antibody (NBP1-90126)

View related products by pathway.

PTMs for mtRNA polymerase Antibody (NBP1-90126)

Learn more about PTMs related to mtRNA polymerase Antibody (NBP1-90126).

Blogs on mtRNA polymerase

There are no specific blogs for mtRNA polymerase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mtRNA polymerase Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol POLRMT
Entrez
Uniprot