Home » mtRNA polymerase » mtRNA polymerase Research Products » mtRNA polymerase Antibody

mtRNA polymerase Antibody

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: mtRNA polymerase Antibody [NBP1-90126] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: mtRNA polymerase Antibody [NBP1-90126] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: mtRNA polymerase Antibody [NBP1-90126] - Staining of human skeletal muscle shows strong granular cytoplasmic positivity in myocytes.
Immunohistochemistry-Paraffin: mtRNA polymerase Antibody [NBP1-90126] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: mtRNA polymerase Antibody [NBP1-90126] - Staining of human prostate shows strong granular positivity in smooth muscle cells.
Immunohistochemistry-Paraffin: mtRNA polymerase Antibody [NBP1-90126] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

mtRNA polymerase Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ELVYVLFMVKDAGLTPDLLSYAAALQCMGRQDQDAGTIERCLEQMSQEGLKLQALFTAVLLSEEDRATVLKAVHKVKPTFSLPPQLPPPVNTSKLLRDVYAKDGRVSYPKLHLPLKTLQCLFEKQLH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
POLRMT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
mtRNA polymerase Protein (NBP1-90126PEP)
Publications
Read Publications using
NBP1-90126 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23070475)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for mtRNA polymerase Antibody

  • APOLMTEC 2.7.7.6
  • DNA-directed RNA polymerase, mitochondrial
  • h-mtRPOL
  • MTRNAP
  • MTRPOL
  • polymerase (RNA) mitochondrial (DNA directed)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

TFB2M Antibody
NBP1-78283
Immunohistochemistry-Paraffin: TFB2M Antibody [NBP1-78283] - 5ug/ml staining of paraffin embedded Human Colon. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Western Blot: TFB2M Antibody [NBP1-78283] - (0.1ug/ml) staining of Human Lung lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
mtTFA Antibody
(18G102B2E11)
NBP1-71648
Western Blot: mtTFA Antibody (18G102B2E11) [NBP1-71648] - Alcohol feeding significantly decreased TFAM expression in rat liver. This image was submitted by a customer review.
Knockdown Validated: mtTFA Antibody (18G102B2E11) [NBP1-71648] - MtDNA depletion and reversible impaired immune functions in THP-1A cells. A and B, Treatment with 50A ng/mL ethidium bromide (EtBr) for 8A weeks. Transfection with 30A nmol/L negative or TFAM siRNA for 8A days. TFAM protein relative toI2-actin. D, MtDNA levels. E, LPS-induced TNF-I+-and IL-8 release. Image collected and cropped by Citeab from the following publication (Mitochondrial DNA depletion induces innate immune dysfunction rescued by IFN-g. J Allergy Clin Immunol (2017)) licensed under a CC-BY licence.
Western Blot: mtTFA Antibody (18G102B2E11) [NBP1-71648] - Induction of mitochondrial biogenesis following exposure of THP-1 cells to LPS. THP-1 cells were incubated with LPS (100 ng/ml) for 0AE
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
TFB1M Antibody
NBP2-13429
Western Blot: TFB1M Antibody [NBP2-13429] - Analysis in control (vector only transfected HEK293T lysate) and TFB1M over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: TFB1M Antibody [NBP2-13429] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P, WB
CSB Antibody
NBP3-03839
CSB Antibody
Species: Hu, Mu, Rt
Applications: IHC, WB
RPL12 Antibody
NBP1-82857
Immunocytochemistry/Immunofluorescence: RPL12 Antibody [NBP1-82857] - Staining of human cell line U-2 OS shows localization to the Golgi apparatus.
Western Blot: RPL12 Antibody [NBP1-82857] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 17Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: RPL12 Antibody [NBP1-82857] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells and decidua cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PTCD3 Antibody
NBP1-84125
Western Blot: PTCD3 Antibody [NBP1-84125] - Analysis using Anti-PTCD3 antibody NBP1-84125 (A) shows similar pattern to independent antibody NBP1-84126 (B).
Immunohistochemistry-Paraffin: PTCD3 Antibody [NBP1-84125] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Immunohistochemistry-Paraffin: PTCD3 Antibody [NBP1-84125] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PLEKHM1 Antibody
NBP2-38449
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human cerebral cortex shows moderate postivity in neuropil.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human fallopian tube shows moderate cytoplasmic postivity in glandular cells.
Immunohistochemistry-Paraffin: PLEKHM1 Antibody [NBP2-38449] - Staining of human placenta shows moderate granular cytoplasmic postivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MTERF Antibody
NBP1-92144
Western Blot: MTERF Antibody [NBP1-92144] - Analysis in control (vector only transfected HEK293T lysate) and MTERF over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: MTERF Antibody [NBP1-92144] - Staining of human urinary bladder shows moderate cytoplasmic positivity in urothelial cells.
Species: Hu
Applications: IHC, IHC-P, WB
CHMP1B Antibody
NBP2-37986
Immunohistochemistry-Paraffin: CHMP1B Antibody [NBP2-37986] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: CHMP1B Antibody [NBP2-37986] - Staining in human thyroid gland and skeletal muscle tissues using anti-CHMP1B antibody. Corresponding CHMP1B RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CHMP1B Antibody [NBP2-37986] - Staining of human thyroid gland shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
TEFM Antibody
NBP2-94080
Immunocytochemistry/Immunofluorescence: TEFM Antibody [NBP2-94080] - Analysis of U2OS cells using TEFM at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: TEFM Antibody [NBP2-94080] - Paraffin-embedded human colon carcinoma using TEFM .
Immunohistochemistry-Paraffin: TEFM Antibody [NBP2-94080] - Paraffin-embedded mouse spleen using TEFM .
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RSL1D1 Antibody
H00026156-B01P
Immunocytochemistry/Immunofluorescence: RSL1D1 Antibody [H00026156-B01P] - Analysis of purified antibody to RSL1D1 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: RSL1D1 Antibody [H00026156-B01P] - Analysis of RSL1D1 expression in A-431.
Western Blot: RSL1D1 Antibody [H00026156-B01P] - Analysis of RSL1D1 expression in transfected 293T cell line by RSL1D1 polyclonal antibody. Lane 1: RSL1D1 transfected lysate(53.9 KDa). Lane 2: Non-transfected lysate.
Species: Hu
Applications: ICC/IF, WB
MRPL12 Antibody
(3B12-1A3)
H00006182-M01
ELISA: MRPL12 Antibody (3B12-1A3) [H00006182-M01] - Detection limit for recombinant GST tagged MRPL12 is approximately 0.03ng/ml as a capture antibody.
Western Blot: MRPL12 Antibody (3B12-1A3) [H00006182-M01] - Analysis of MRPL12 expression in transfected 293T cell line by MRPL12 monoclonal antibody (M01), clone 3B12-1A3.Lane 1: MRPL12 transfected lysate(21.3 KDa).Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: MRPL12 Antibody (3B12-1A3) [H00006182-M01] - Analysis of monoclonal antibody to MRPL12 on HeLa cell. Antibody concentration 10 ug/ml.
(5 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
RPL7 Antibody
NB100-2269
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Human ovarian carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Immunohistochemistry-Paraffin: RPL7 Antibody [NB100-2269] - Mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-RPL7 used at a dilution of 1:1,000 (0.2ug/ml). Detection: DAB
Western Blot: RPL7 Antibody [NB100-2269] - Detection of human and mouse RPL7 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, HEK293T, Jurkat, mouse TMCK-1, and mouse NIH 3T3 cells prepared using RIPA lysis buffer. Antibody: Affinity purified rabbit anti-RPL7 antibody NB100-2269 used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.
(8 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, KD, WB
Recombinant Human
IGKV1-5 GST (N-Term) ...
H00028299-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
SSBP1 Antibody
NBP1-80720
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Analysis in human testis and pancreas tissues using HPA002866 antibody. Corresponding SSBP1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SSBP1 Antibody [NBP1-80720] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
(5 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-P, KD, WB
SSRP1 Antibody
NBP2-80439
Flow Cytometry: SSRP1 Antibody [NBP2-80439] - Analysis of SSRP1 was done on SH-SY5Y cells. The cells were fixed, permeabilized and stained with the primary antibody (1/50) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated Goat anti-Rabbit IgG Secondary antibody at 1/1000 dilution for 30 minutes. Unlabeled sample was used as a control (cells without incubation with primary antibody; black).
Immunohistochemistry-Paraffin: SSRP1 Antibody [NBP2-80439] - Analysis in rat testis tissue using SSRP1 antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with dd
Immunohistochemistry-Paraffin: SSRP1 Antibody [NBP2-80439] - Analysis in human skin tissue using SSRP1 antibody. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH 6.0) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with dd
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NKRF Antibody
NBP3-10499
Western Blot: NKRF Antibody [NBP3-10499] - Western blot analysis using NBP3-10499 on Human Muscle as a positive control. Antibody Titration: 0.2-1 ug/ml
Species: Hu
Applications: IHC, WB
Neuropeptide B
Antibody
NBP3-05567
Immunocytochemistry/Immunofluorescence: Neuropeptide B Antibody [NBP3-05567] - Immunofluorescence analysis of HeLa cells using Neuropeptide B Rabbit pAb (NBP3-05567) at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: Neuropeptide B Antibody [NBP3-05567] - Immunofluorescence analysis of NIH/3T3 cells using Neuropeptide B Rabbit pAb (NBP3-05567) at dilution of 1:100. Blue: DAPI for nuclear staining.
Western Blot: Neuropeptide B Antibody [NBP3-05567] - Western blot analysis of extracts of various cell lines, using Neuropeptide B antibody (NBP3-05567) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for mtRNA polymerase Antibody (NBP1-90126)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for mtRNA polymerase Antibody (NBP1-90126) (0)

There are no reviews for mtRNA polymerase Antibody (NBP1-90126). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for mtRNA polymerase Antibody (NBP1-90126) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional mtRNA polymerase Products

Bioinformatics Tool for mtRNA polymerase Antibody (NBP1-90126)

Discover related pathways, diseases and genes to mtRNA polymerase Antibody (NBP1-90126). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for mtRNA polymerase Antibody (NBP1-90126)

Discover more about diseases related to mtRNA polymerase Antibody (NBP1-90126).
 

Pathways for mtRNA polymerase Antibody (NBP1-90126)

View related products by pathway.

PTMs for mtRNA polymerase Antibody (NBP1-90126)

Learn more about PTMs related to mtRNA polymerase Antibody (NBP1-90126).

Blogs on mtRNA polymerase

There are no specific blogs for mtRNA polymerase, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our mtRNA polymerase Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol POLRMT
Entrez
Uniprot