TET3 Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1525-1660 of human TET3 (NP_001274420.1). LAGPSLTEKPWALGAGDFNSALKGSPGFQDKLWNPMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSLEEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAPAH |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TET3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS with 50% glycerol, pH7.3. |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for TET3 Antibody - BSA Free
Background
TET3 may catalyze the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Fi, Ha, Hu, Mu, Pm, Rb, Rt, Re, Sh
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, PAGE, Simple Western, WB
Species: Bv, Hu, Mu, Po
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
Species: Hu, Mu
Applications: ChIP, ICC/IF, IHC, IP, KO, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ChIP, ICC, IP, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ChIP, ICC, IHC, Simple Western, WB
Species: Bv, Ca, Ch, Dr, Gt, Gp, Ha, Hu, Pm, Mu, Po, Rb, Rt, Sh, Sq, Xp
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, IP, WB
Publications for TET3 Antibody (NBP3-04740) (0)
There are no publications for TET3 Antibody (NBP3-04740).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TET3 Antibody (NBP3-04740) (0)
There are no reviews for TET3 Antibody (NBP3-04740).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TET3 Antibody (NBP3-04740) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TET3 Products
Research Areas for TET3 Antibody (NBP3-04740)
Find related products by research area.
|
Blogs on TET3