Novus Biologicals products are now on bio-techne.com

TESK1 Antibody (1D11)

Images

 
Western Blot: TESK1 Antibody (1D11) [H00007016-M01] - Detection against Immunogen (36.63 KDa) .

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA
Clone
1D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TESK1 Antibody (1D11) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
TESK1 (AAH67130, 266 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DFGLDVPAFRTLVGDDCPLPFLLLAIHCCNLEPSTRAPFTEITQHLEWILEQLPEPAPLTRTALTHNQGSVARGGPSATLPRPDPRLSRSRSDLFLPPSP
Specificity
TESK1 - testis-specific kinase 1
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TESK1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00007016-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TESK1 Antibody (1D11)

  • dual specificity testis-specific protein kinase 1
  • EC 2.7.12.1
  • Testicular protein kinase 1
  • testis-specific kinase 1

Background

This gene product is a serine/threonine protein kinase that contains an N-terminal protein kinase domain and a C-terminal proline-rich domain. Its protein kinase domain is most closely related to those of the LIM motif-containing protein kinases (LIMKs). The encoded protein can phosphorylate myelin basic protein and histone in vitro. The testicular germ cell-specific expression and developmental pattern of expression of the mouse gene suggests that this gene plays an important role at and after the meiotic phase of spermatogenesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
H00058524-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
H00010420-M04
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90195
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5070
Species: Hu
Applications: Simple Western, WB
NBP2-00748
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-46326
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IF, IHC, IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-84843
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5067
Species: Hu
Applications: WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP1-89864
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P
AF4819
Species: Hu
Applications: ICC, WB
H00007016-M01
Species: Hu, Mu
Applications: WB, ELISA

Publications for TESK1 Antibody (H00007016-M01)(1)

Reviews for TESK1 Antibody (H00007016-M01) (0)

There are no reviews for TESK1 Antibody (H00007016-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TESK1 Antibody (H00007016-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TESK1 Products

Array H00007016-M01

Research Areas for TESK1 Antibody (H00007016-M01)

Find related products by research area.

Blogs on TESK1

There are no specific blogs for TESK1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TESK1 Antibody (1D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TESK1
Entrez
OMIM
Uniprot