TAO Kinase 1 Antibody

Images

 
Immunohistochemistry-Paraffin: TAO Kinase 1 Antibody [NBP1-89864] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAO Kinase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAOK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TAO Kinase 1 Protein (NBP1-89864PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAO Kinase 1 Antibody

  • EC 2.7.11
  • FLJ14314
  • hKFC-B
  • KIAA1361STE20-like kinase PSK2
  • Kinase from chicken homolog B
  • MAP3K16EC 2.7.11.1
  • MARKKmicrotubule affinity regulating kinase kinase
  • PSK2serine/threonine kinase TAO1
  • serine/threonine-protein kinase TAO1
  • TAO kinase 1
  • TAO1serine/threonine protein kinase TAO1 homolog
  • Thousand and one amino acid protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PPS037
Species: Hu, Mu, Rt, Xp
Applications: WB
NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, IHC-P, IP
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP2-30662
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55795
Species: Hu
Applications: ICC/IF
AF4185
Species: Hu
Applications: ICC
MAB4916
Species: Mu
Applications: WB, IHC
NBP1-89864
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for TAO Kinase 1 Antibody (NBP1-89864) (0)

There are no publications for TAO Kinase 1 Antibody (NBP1-89864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAO Kinase 1 Antibody (NBP1-89864) (0)

There are no reviews for TAO Kinase 1 Antibody (NBP1-89864). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TAO Kinase 1 Antibody (NBP1-89864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAO Kinase 1 Products

Bioinformatics Tool for TAO Kinase 1 Antibody (NBP1-89864)

Discover related pathways, diseases and genes to TAO Kinase 1 Antibody (NBP1-89864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAO Kinase 1 Antibody (NBP1-89864)

Discover more about diseases related to TAO Kinase 1 Antibody (NBP1-89864).
 

Pathways for TAO Kinase 1 Antibody (NBP1-89864)

View related products by pathway.

Research Areas for TAO Kinase 1 Antibody (NBP1-89864)

Find related products by research area.

Blogs on TAO Kinase 1

There are no specific blogs for TAO Kinase 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAO Kinase 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAOK1