TAO Kinase 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TAO Kinase 1 Antibody [NBP1-89864] - TAO1 staining in human SH-SY5Y cell line. ICC/IF image submitted by a verified customer review.
Immunohistochemistry-Paraffin: TAO Kinase 1 Antibody [NBP1-89864] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Immunocytochemistry/ Immunofluorescence: TAO Kinase 1 Antibody [NBP1-89864] - Staining of human cell line A-431 shows localization to vesicles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ELISA, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAO Kinase 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LSPEAFSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRSTSVTSQISNGSH
Specificity
Specificity of human TAO Kinase 1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAOK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. This TAO Kinase 1 Antibody is validated for ELISA from a verified customer review.
Control Peptide
TAO Kinase 1 Protein (NBP1-89864PEP)
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-89864 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2), 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TAO Kinase 1 Antibody

  • EC 2.7.11
  • FLJ14314
  • hKFC-B
  • KIAA1361STE20-like kinase PSK2
  • Kinase from chicken homolog B
  • MAP3K16EC 2.7.11.1
  • MARKKmicrotubule affinity regulating kinase kinase
  • PSK2serine/threonine kinase TAO1
  • serine/threonine-protein kinase TAO1
  • TAO kinase 1
  • TAO1serine/threonine protein kinase TAO1 homolog
  • Thousand and one amino acid protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52508
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-87833
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-563
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-02673
Species: Hu, Bt, Bv, Ca, Pm, Pm, Rb
Applications: IHC, IHC-P
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KO
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-14834
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
NBP2-30662
Species: Hu
Applications: WB, IHC, IHC-P
NB100-79842
Species: Hu, Mu
Applications: WB, IP
NBP1-88626
Species: Hu
Applications: IHC, IHC-P
AF4916
Species: Hu, Mu
Applications: WB, IHC

Publications for TAO Kinase 1 Antibody (NBP1-89864) (0)

There are no publications for TAO Kinase 1 Antibody (NBP1-89864).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAO Kinase 1 Antibody (NBP1-89864) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-89864:
Filter by Applications
ELISA
(1)
ICC
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
ELISA TAO Kinase 1 NBP1-89864
Enlarge
reviewed by:
Anonymous
ELISA Human 09/18/2020
View

Summary

ApplicationELISA
Sample TestedSH-SY5Y Cell lysates
SpeciesHuman
Lot150724
Immunocytochemistry TAO Kinase 1 NBP1-89864
Enlarge
reviewed by:
Anonymous
ICC Human 08/20/2020
View

Summary

ApplicationImmunocytochemistry
Sample TestedSH-SY5Y Cell Line
SpeciesHuman
Lot150724

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TAO Kinase 1 Antibody (NBP1-89864) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TAO Kinase 1 Products

Bioinformatics Tool for TAO Kinase 1 Antibody (NBP1-89864)

Discover related pathways, diseases and genes to TAO Kinase 1 Antibody (NBP1-89864). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAO Kinase 1 Antibody (NBP1-89864)

Discover more about diseases related to TAO Kinase 1 Antibody (NBP1-89864).
 

Pathways for TAO Kinase 1 Antibody (NBP1-89864)

View related products by pathway.

Research Areas for TAO Kinase 1 Antibody (NBP1-89864)

Find related products by research area.

Blogs on TAO Kinase 1

There are no specific blogs for TAO Kinase 1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Anonymous
09/18/2020
Application: ELISA
Species: Human

Anonymous
08/20/2020
Application: ICC
Species: Human

Bioinformatics

Gene Symbol TAOK1