| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TERT |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TERT Antibody (NBP2-56116)Find related products by research area.
|
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
|
Reversing Cancer with Telomerase Reverse Transcriptase (TERT) Telomerase reverse transcriptase (TERT) is a ribonucleoprotein enzyme essential for eukaryotic chromosomal termini replication. It is a useful marker as it is active only in progenitor and most cancer cells, but inactive or (active at very low activit... Read full blog post. |
|
Featured Product Citation using Novus' hTERT Antibody In December 2009, researchers at the University of Southern California cited using Novus’ mouse monoclonal Telomerase Reverse Transcriptase Antibody (cat# NB100-317) [PMID: 19923445]. Specifically, Novus’ hTERT antibody was used for immunofluorescent ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TERT |