Tenascin R Antibody (1D12)

Images

 
Sandwich ELISA: Tenascin R Antibody (1D12) [H00007143-M01] - Detection limit for recombinant GST tagged TNR is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
1D12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Tenascin R Antibody (1D12) Summary

Immunogen
TNR (NP_003276 411 a.a. - 519 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VATHLSTPQGLQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTV
Specificity
TNR - tenascin R (restrictin, janusin)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TNR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Tenascin R Antibody (1D12)

  • Janusin
  • MGC149328
  • Restrictin
  • tenascin R (restrictin, janusin)
  • Tenascin R
  • tenascin-R
  • TNR
  • TN-R

Background

Tenascin-R (TNR) is an extracellular matix protein expressed primarily in the central nervous system. It is a member of the tenascin (TN) gene family, which includes at least 3 genes in mammals: TNC (or hexabrachion; MIM 187380), TNX (TNXB; MIM 600985), and TNR (Erickson, 1993 [PubMed 7694605]). The genes are expressed in distinct tissues at different times during embryonic development and are present in adult tissues.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF5800
Species: Mu, Rt
Applications: WB, IHC
MAB2688
Species: Hu
Applications: WB
AF4009
Species: Hu, Rt
Applications: WB, IHC, IP, ICC
AF904
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, Neut
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
H00007134-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-83939
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB24601
Species: Hu
Applications: WB, IP, Neut
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Tenascin R Antibody (H00007143-M01) (0)

There are no publications for Tenascin R Antibody (H00007143-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tenascin R Antibody (H00007143-M01) (0)

There are no reviews for Tenascin R Antibody (H00007143-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tenascin R Antibody (H00007143-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tenascin R Products

Bioinformatics Tool for Tenascin R Antibody (H00007143-M01)

Discover related pathways, diseases and genes to Tenascin R Antibody (H00007143-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tenascin R Antibody (H00007143-M01)

Discover more about diseases related to Tenascin R Antibody (H00007143-M01).
 

Pathways for Tenascin R Antibody (H00007143-M01)

View related products by pathway.

PTMs for Tenascin R Antibody (H00007143-M01)

Learn more about PTMs related to Tenascin R Antibody (H00007143-M01).

Blogs on Tenascin R

There are no specific blogs for Tenascin R, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tenascin R Antibody (1D12) and receive a gift card or discount.

Bioinformatics

Gene Symbol TNR
Entrez
OMIM
Uniprot