TEAD2 Antibody (2D5)

Product Discontinued

TEAD2 Antibody (2D5) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TEAD2 (NP_003589, 218 a.a. ~ 307 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. WQARGLGTARLQLVEFSAFVEPPDAVDSYQRHLFVHISQHCPSPGAPPLESVDVRQIYDKFPEKKGGLRELYDRGPPHAFFLVKFWADLN
• Specificity: TEAD2 - TEA domain family member 2
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TEAD2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TEAD2 Antibody (2D5)

• TEA domain family member 2TEF4ETF
• TEAD-2
• TEF-4
• transcriptional enhancer factor TEF-4

Background

Putative transcription factor that binds to the SPH and GT-IIC "enhansons" (5'-GTGGAATGT-3'). May be involved in the gene regulation of neural development. Binds to the M-CAT motif

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TEAD2 Antibody (H00008463-M01)(1)

Publication using H00008463-M01

• Zhou PJ, Xue W, Peng J et al. Elevated expression of Par3 promotes prostate cancer metastasis by forming a Par3/aPKC/KIBRA complex and inactivating the hippo pathway. J Exp Clin Cancer Res 2017-10-10 [PMID: 29017577]

Bioinformatics

• Gene Symbol: TEAD2
• Entrez:
  • 8463(Human)
• OMIM:
  • 601729(Human)
• Uniprot:
  • NP_003589(Human)