TDRD5 Antibody

Images

 
Immunohistochemistry-Paraffin: TDRD5 Antibody [NBP1-81971] - Staining of human testis shows strong cytoplasmic positivity in subsets of cells in seminiferous ducts.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TDRD5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AMANHDIPPDAVPNKKLCRLPPLDTSSLIGVFVEYIISPSQFYIRIYSRDSSELLEDMMIEMRRCYSNQLVSDRYVMPECFIQPGHLCCVRISEDKWWYRVIIHRVLEKQEVEVFYPDFGNIGIVQKSSLRFLKCCYTK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TDRD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TDRD5 Protein (NBP1-81971PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDRD5 Antibody

  • FLJ34823
  • RP11-427G13.1
  • tudor domain containing 5
  • tudor domain-containing protein 5
  • TUDOR3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37398
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF6296
Species: Hu
Applications: WB
AF6548
Species: Hu, Mu
Applications: IHC
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP1-83782
Species: Hu
Applications: IHC, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-87854
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
NB120-16518
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81971
Species: Hu, Rt
Applications: IHC, IHC-P

Publications for TDRD5 Antibody (NBP1-81971) (0)

There are no publications for TDRD5 Antibody (NBP1-81971).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TDRD5 Antibody (NBP1-81971) (0)

There are no reviews for TDRD5 Antibody (NBP1-81971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TDRD5 Antibody (NBP1-81971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDRD5 Products

Bioinformatics Tool for TDRD5 Antibody (NBP1-81971)

Discover related pathways, diseases and genes to TDRD5 Antibody (NBP1-81971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDRD5 Antibody (NBP1-81971)

Discover more about diseases related to TDRD5 Antibody (NBP1-81971).
 

Pathways for TDRD5 Antibody (NBP1-81971)

View related products by pathway.

PTMs for TDRD5 Antibody (NBP1-81971)

Learn more about PTMs related to TDRD5 Antibody (NBP1-81971).

Blogs on TDRD5

There are no specific blogs for TDRD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDRD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDRD5