TDP1 Antibody (2A10-G2) - Azide and BSA Free Summary
| Immunogen |
TDP1 (AAH15474.1, 1 a.a. ~ 608 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSEAQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEMPQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGEGQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSAQFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISLCQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSPLYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSETNVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSSVGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRPSPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGLDSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDTHGNMWVPS |
| Specificity |
TDP1 - tyrosyl-DNA phosphodiesterase 1 |
| Isotype |
IgG1 Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TDP1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot 1:500
|
| Application Notes |
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Publications |
|
Reactivity Notes
Human. Other species not tested.
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TDP1 Antibody (2A10-G2) - Azide and BSA Free
Background
The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same isoform.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, PLA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Rt
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Bv(-), Hu, Mu(-), Pm, Rt(-)
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: WB, ELISA
Publications for TDP1 Antibody (H00055775-M01)(1)
Showing Publication 1 -
1 of 1.
Reviews for TDP1 Antibody (H00055775-M01) (0)
There are no reviews for TDP1 Antibody (H00055775-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TDP1 Antibody (H00055775-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TDP1 Products
Research Areas for TDP1 Antibody (H00055775-M01)
Find related products by research area.
|
Blogs on TDP1