TDO2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TDO2 Antibody [NBP2-13424] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: TDO2 Antibody [NBP2-13424] - Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Product Discontinued
View other related TDO2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-13424
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

TDO2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVA EFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TDO2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publications using
NBP2-13424 in the following applications:

  • IHC
    2 publications
  • 2 publications

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27190010). Rat (87%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TDO2 Antibody

  • chky
  • TDO
  • TDO2
  • TDOTO
  • TO
  • TPH2EC 1.13.11.11
  • TRPO
  • TRPOtryptophanase
  • Tryptamin 2,3-dioxygenase
  • tryptophan 2,3-dioxygenase
  • Tryptophan Oxygenase
  • Tryptophan Pyrrolase
  • Tryptophanase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87702
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF5276
Species: Hu
Applications: WB, IHC
H00006532-M06
Species: Hu
Applications: ELISA, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29936
Species: Hu, Mu
Applications: WB, Flow, IHC-P
MAB7389
Species: Mu
Applications: WB, IHC
NBP1-88370
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-01506
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85892
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-01752
Species: Hu
Applications: WB, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP2-02332
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13424
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for TDO2 Antibody (NBP2-13424)(4)

Reviews for TDO2 Antibody (NBP2-13424) (0)

There are no reviews for TDO2 Antibody (NBP2-13424). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TDO2 Antibody (NBP2-13424) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TDO2 Products

Bioinformatics Tool for TDO2 Antibody (NBP2-13424)

Discover related pathways, diseases and genes to TDO2 Antibody (NBP2-13424). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TDO2 Antibody (NBP2-13424)

Discover more about diseases related to TDO2 Antibody (NBP2-13424).
 

Pathways for TDO2 Antibody (NBP2-13424)

View related products by pathway.

PTMs for TDO2 Antibody (NBP2-13424)

Learn more about PTMs related to TDO2 Antibody (NBP2-13424).

Blogs on TDO2

There are no specific blogs for TDO2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TDO2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TDO2
Entrez