TDO2 Antibody

Product Discontinued

TDO2 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVA EFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TDO2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 27190010). Rat (87%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TDO2 Antibody

• chky
• TDO
• TDO2
• TDOTO
• TO
• TPH2EC 1.13.11.11
• TRPO
• TRPOtryptophanase
• Tryptamin 2,3-dioxygenase
• tryptophan 2,3-dioxygenase
• Tryptophan Oxygenase
• Tryptophan Pyrrolase
• Tryptophanase

Background

Tryptophan 2,3-dioxygenase (EC 1.13.11.11) plays a role in catalyzing the first and rat-limiting step in the kynurenine pathway, the major pathway of tryptophan metabolism.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TDO2 Antibody (NBP2-13424)(4)

Publications using NBP2-13424

• Novikov O, Wang Z, Stanford Ea et al. An Aryl Hydrocarbon Receptor-mediated Amplification Loop that Enforces Cell Migration in ER-/PR-/Her2- Human Breast Cancer Cells. Mol. Pharmacol. 2016-08-29 [PMID: 27573671] (IHC-P)
• Woodling NS, Colas D, Wang Q et al. Cyclooxygenase inhibition targets neurons to prevent early behavioural decline in Alzheimer's disease model mice. Brain. 2016-05-13 [PMID: 27190010] (IF/IHC, Mouse)
• Guastella AR, Michelhaugh SK, Klinger NV et al. Tryptophan PET Imaging of the kynurenine Pathway in Patient-Derived Xenograft Models of Glioblastoma. Mol Imaging. 2016-05-06 [PMID: 27151136] (IHC-P, Human)
• Bosnyak E, Kamson DO, Guastella AR et al. Molecular imaging correlates of tryptophan metabolism via the kynurenine pathway in human meningiomas. Neuro Oncol 2015-09-01 [PMID: 26092774] (IF/IHC)

Bioinformatics

• Gene Symbol: TDO2