TCR alpha Antibody (4H8)

Images

 
Sandwich ELISA: TCR alpha Antibody (4H8) [H00006955-M03] - Detection limit for recombinant GST tagged TRA@ is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TCR alpha Antibody (4H8) Summary

Immunogen
TRA (CAA25651.1, 133 a.a. - 232 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLV
Specificity
TRA@ - T cell receptor alpha locus (4H8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCR alpha Antibody (4H8)

  • C)
  • D
  • FLJ22602
  • J
  • MGC117436
  • MGC22624
  • MGC23964
  • MGC71411
  • T cell receptor alpha locus
  • T-cell antigen receptor, alpha polypeptide
  • T-cell receptor, alpha (V
  • TCRA
  • TCRD
  • TRA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006976-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-74080
Species: Hu
Applications: WB
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00009278-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF4348
Species: Hu, Mu, Rt
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP1-80669
Species: Hu
Applications: IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-41371
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
NB100-178
Species: Hu, Mu(-)
Applications: WB, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB120-2781
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-Fr
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TCR alpha Antibody (H00006955-M03) (0)

There are no publications for TCR alpha Antibody (H00006955-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCR alpha Antibody (H00006955-M03) (0)

There are no reviews for TCR alpha Antibody (H00006955-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCR alpha Antibody (H00006955-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCR alpha Products

Bioinformatics Tool for TCR alpha Antibody (H00006955-M03)

Discover related pathways, diseases and genes to TCR alpha Antibody (H00006955-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCR alpha Antibody (H00006955-M03)

Discover more about diseases related to TCR alpha Antibody (H00006955-M03).
 

Pathways for TCR alpha Antibody (H00006955-M03)

View related products by pathway.

Research Areas for TCR alpha Antibody (H00006955-M03)

Find related products by research area.

Blogs on TCR alpha.

CD3 (OKT3) as a marker of immune response efficiency
Our immune system is a powerful defense mechanism against infection, however different variables can cause our immune response to work for or against us.  CD3 (cluster of differentiation 3) is one component of our immune signal response that is co...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCR alpha Antibody (4H8) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRA
Entrez
Uniprot