TCFL5 Antibody

Images

 
Western Blot: TCFL5 Antibody [NBP2-88424] - WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysateTCFL5 is supported by BioGPS gene expression data to be ...read more
Immunohistochemistry: TCFL5 Antibody [NBP2-88424] - Human kidney

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCFL5 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TCFL5. Peptide sequence: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
TCFL5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCFL5 Antibody

  • bHLHe82
  • Cha transcription factor
  • CHA
  • CHAMGC46135
  • E2BP1
  • E2BP-1HPV-16 E2 binding protein 1
  • Figlb
  • HPV-16 E2-binding protein 1
  • transcription factor-like 5 (basic helix-loop-helix)
  • transcription factor-like 5 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89342
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-73857
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready
AF6457
Species: Hu
Applications: WB
NBP2-73859
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF009
Species: Hu
Applications: WB, IHC
NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP1-47704
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30052
Species: Hu, Mu, Rt, Ch, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl, IHC-WhMt
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, KD
NBP1-39474
Species: Hu, Mu, Rt, Po, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-88191
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-67339
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, IP
NBP2-12446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IM, IP, KD
NBP2-67232
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TCFL5 Antibody (NBP2-88424) (0)

There are no publications for TCFL5 Antibody (NBP2-88424).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCFL5 Antibody (NBP2-88424) (0)

There are no reviews for TCFL5 Antibody (NBP2-88424). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCFL5 Antibody (NBP2-88424) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TCFL5 Products

Array NBP2-88424

Bioinformatics Tool for TCFL5 Antibody (NBP2-88424)

Discover related pathways, diseases and genes to TCFL5 Antibody (NBP2-88424). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCFL5 Antibody (NBP2-88424)

Discover more about diseases related to TCFL5 Antibody (NBP2-88424).
 

Pathways for TCFL5 Antibody (NBP2-88424)

View related products by pathway.

Research Areas for TCFL5 Antibody (NBP2-88424)

Find related products by research area.

Blogs on TCFL5

There are no specific blogs for TCFL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCFL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCFL5