![Western Blot: TCFL5 Antibody [NBP2-88424] - WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysateTCFL5 is supported by BioGPS gene expression data to be expressed in HepG2](http://images.novusbio.com/fullsize2/TCFL5 Antibody-Western Blot-NBP2-88424-img0002.jpg "Western Blot: TCFL5 Antibody [NBP2-88424] - WB Suggested Anti-TCFL5 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: HepG2 cell lysateTCFL5 is supported by BioGPS gene expression data to be expressed in HepG2")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IHC-P |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TCFL5. Peptide sequence: TLIRHPSELMNVPLQQQNKCTALVKNKTAATTTALQFTYPLFTTNACSTS The peptide sequence for this immunogen was taken from within the described region. |
| Predicted Species | Mouse (93%), Rat (93%). Backed by our 100% Guarantee. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TCFL5 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![RFC1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "RFC1 Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Diseases for TCFL5 Antibody (NBP2-88424)Discover more about diseases related to TCFL5 Antibody (NBP2-88424).
| Pathways for TCFL5 Antibody (NBP2-88424)View related products by pathway.
|
Research Areas for TCFL5 Antibody (NBP2-88424)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TCFL5 |
![Immunohistochemistry: TCFL5 Antibody [NBP2-88424] - Human kidney](http://images.novusbio.com/fullsize2/TCFL5-Antibody-Immunohistochemistry-NBP2-88424-img0001.jpg "Immunohistochemistry: TCFL5 Antibody [NBP2-88424] - Human kidney")
![Immunohistochemistry-Paraffin: ATP6V0A1 Antibody [NBP1-89342] - Analysis in human cerebral cortex and tonsil tissues. Corresponding ATP6V0A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/ATP6V0A1-Antibody-Immunohistochemistry-Paraffin-NBP1-89342-img0015.jpg)
![Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Pull-down assay with AP-3 antibody using total lysates from untreated (lane 1) and bromopalmitate-treated (lane 2) WT brain slices to detect V0a1 and its densitometric quantitation (n=4, *P<0.05). HEK-293 cells were transfected with WT GFP-V0a1 and GFP-V0a1-Cys25Ser mutant construct, and pull-down experiments were conducted with AP-3 antibody to detect GFP-V0a1,*P<0.05(n=4). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY licence.](http://images.novusbio.com/images2/ATP6V0A1 Antibody-Western Blot-NBP1-89342-img0018.jpg)
![Western Blot: ATP6V0A1 Antibody [NBP1-89342] - In Cln1-/- mice V0a1 is misrouted to plasma membrane preventing its interaction with AP-3. Western blot analysis and densitometric quantitation of V0a1 in isolated plasma membrane fraction from WT and Cln1-/- mouse brain (n=4, *P<0.05). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms14612), licensed under a CC-BY licence.](http://images.novusbio.com/images2/ATP6V0A1-Antibody-Western-Blot-NBP1-89342-img0017.jpg)
![Western Blot: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC2.](http://images.novusbio.com/images2/RFC2-Antibody-(OTI2B2)---Azide-and-BSA-Free-Western-Blot-NBP2-73857-img0001.jpg)
![Immunohistochemistry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of Human prostate tissue.](http://images.novusbio.com/images2/RFC2-Antibody-(OTI2B2)---Azide-and-BSA-Free-Immunohistochemistry-NBP2-73857-img0012.jpg)
![Flow Cytometry: RFC2 Antibody (OTI2B2) - Azide and BSA Free [NBP2-73857] - Analysis of HEK293T cells transfected with either overexpress plasmid(Red) or empty vector control plasmid(Blue) were immunostaining by RFC2 antibody.](http://images.novusbio.com/images2/RFC2-Antibody-(OTI2B2)---Azide-and-BSA-Free-Flow-Cytometry-NBP2-73857-img0002.jpg)
![Western Blot: RFC4 Antibody (OTI1A8) - Azide and BSA Free [NBP2-73859] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY RFC4.](http://images.novusbio.com/images2/RFC4-Antibody-(OTI1A8)---Azide-and-BSA-Free-Western-Blot-NBP2-73859-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: RFC4 Antibody (OTI1A8) - Azide and BSA Free [NBP2-73859] - Analysis of COS7 cells transiently transfected by pCMV6-ENTRY RFC4.](http://images.novusbio.com/images2/RFC4 Antibody (OTI1A8) - Azide and BSA Free-Immunocytochemistry-Immunofluorescence-NBP2-73859-img0006.jpg)
![Immunohistochemistry: RFC4 Antibody (OTI1A8) - Azide and BSA Free [NBP2-73859] - Analysis of Human tonsil tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)](http://images.novusbio.com/images2/RFC4-Antibody-(OTI1A8)---Azide-and-BSA-Free-Immunohistochemistry-NBP2-73859-img0005.jpg)
![Western Blot: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of alpha sarcoglycan on rat heart tissue lysates using anti-alpha sarcoglycan antibody at 1:500 dilution.](http://images.novusbio.com/images2/alpha-Sarcoglycan-Antibody-(JA51-81)-Western-Blot-NBP2-67150-img0003.jpg)
![Immunohistochemistry-Frozen: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Human skeletal muscle tissue. IHC-Fr image submitted by a verified customer review.](http://images.novusbio.com/images2/alpha-Sarcoglycan-Antibody-(JA51-81)-Immunohistochemistry-Frozen-NBP2-67150-img0005.jpg)
![Immunohistochemistry-Paraffin: alpha-Sarcoglycan Antibody (JA51-81) [NBP2-67150] - Analysis of paraffin-embedded mouse heart tissue using anti-alpha sarcoglycan antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/alpha-Sarcoglycan-Antibody-(JA51-81)-Immunohistochemistry-Paraffin-NBP2-67150-img0001.jpg)
![Western Blot: Adenosine A1R Antibody [NB300-549] - Analysis was performed on whole cell extracts (30 ug lysate) of PC 12 (Lane 1), SH-SY5Y (lane 2), U-87MG (lane 3), A549 (Lane 4) and K-562 (lane 5).](http://images.novusbio.com/images2/Adenosine-A1-R-Antibody-Western-Blot-NB300-549-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Adenosine A1R Antibody [NB300-549] - Analysis of Adenosine Receptor A1 was done on 70% confluent log phase HeLa cells.](http://images.novusbio.com/images2/Adenosine-A1-R-Antibody-Immunocytochemistry-Immunofluorescence-NB300-549-img0007.jpg)
![Immunohistochemistry-Paraffin: Adenosine A1R Antibody [NB300-549] - Analysis showing positive staining in the cytoplasm of Rat brain tissue (right) compared with a negative control in the absence of primary antibody (left).](http://images.novusbio.com/images2/Adenosine A1 R Antibody-Immunohistochemistry-Paraffin-NB300-549-img0003.jpg)
![Western Blot: GPHA2 Antibody [NBP3-04883] - Analysis of extracts of rat brain, using GPHA2 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit.](http://images.novusbio.com/images2/GPHA2 Antibody-Western Blot-NBP3-04883-img0001.jpg)
![Western Blot: ATP6V0A2 Antibody [NBP1-59069] - HeLa cells, concentration 3.3 ug/ml.](http://images.novusbio.com/images2/ATP6V0A2-Antibody-Western-Blot-NBP1-59069-img0002.jpg)
![Immunohistochemistry: ATP6V0A2 Antibody [NBP1-59069] - Human kidney lysate tissue at an antibody concentration of 5.0 ug/ml using anti-ATP6V0A2 antibody](http://images.novusbio.com/images2/ATP6V0A2-Antibody-Immunohistochemistry-NBP1-59069-img0008.jpg)
![Western Blot: ATP6V0A2 Antibody [NBP1-59069] - Hela tissue lysate at a concentration of 1ug/ml.](http://images.novusbio.com/images2/ATP6V0A2-Antibody-Western-Blot-NBP1-59069-img0001.jpg)
![Immunohistochemistry-Paraffin: Dehydrodolichyl Diphosphate Synthase Antibody [NBP1-84975] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.](http://images.novusbio.com/images2/Dehydrodolichyl-Diphosphate-Synthase-Antibody-Immunohistochemistry-Paraffin-NBP1-84975-img0002.jpg)
![Western Blot: Carboxypeptidase A1/CPA1 Antibody (2A3) [NBP1-47704] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Carboxypeptidase A(Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Carboxypeptidase A.](http://images.novusbio.com/images2/Carboxypeptidase-A1-CPA1-Antibody-(2A3)-Western-Blot-NBP1-47704-img0022.jpg)
![Immunocytochemistry/Immunofluorescence: Carboxypeptidase A1/CPA1 Antibody (2A3) [NBP1-47704] - Staining (Red) of COS7 cells transiently transfected by pCMV6-ENTRY Carboxypeptidase A.](http://images.novusbio.com/images2/Carboxypeptidase-A1-CPA1-Antibody-(2A3)-Immunocytochemistry-Immunofluorescence-NBP1-47704-img0012.jpg)
![Immunohistochemistry-Paraffin: Carboxypeptidase A1/CPA1 Antibody (2A3) [NBP1-47704] - Staining of paraffin-embedded liver using anti-Carboxypeptidase A mouse monoclonal antibody.](http://images.novusbio.com/images2/Carboxypeptidase-A1-CPA1-Antibody-(2A3)-Immunohistochemistry-Paraffin-NBP1-47704-img0021.jpg)
![Western Blot: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brain lysate showing specific immunolabeling of the ~70k ChAT.](http://images.novusbio.com/images2/Choline-Acetyltransferase-ChAT-Antibody-Western-Blot-NBP1-30052-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Representative images of lumbar spinal cord sections at 130 days immunostained with Choline Acetyltransferase/ChAT. Scale bar, 200 um. Image collected and cropped by CiteAb from the following publication (http://embomolmed.embopress.org/lookup/doi/10.15252/emmm.201808888), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Choline-Acetyltransferase-ChAT-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-30052-img0005.jpg)
![Immunohistochemistry-Paraffin: Choline Acetyltransferase/ChAT Antibody [NBP1-30052] - Rat brainstem showing specific labeling using the anti-ChAT antibody. Image courtesy of Dr. Robert Sloviter, University of Arizona.](http://images.novusbio.com/images2/Choline-Acetyltransferase-ChAT-Antibody-Immunohistochemistry-Paraffin-NBP1-30052-img0003.jpg)
![Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Staining of human duodenum, small intestine, stomach and testis using Anti-Adenosine Deaminase/ADA antibody NBP1-87404 (A) shows similar protein distribution across tissues to independent antibody NBP1-90361 (B).](http://images.novusbio.com/images2/Adenosine-Deaminase-ADA-Antibody-Immunohistochemistry-Paraffin-NBP1-87404-img0027.jpg)
![Immunohistochemistry-Paraffin: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in human duodenum and testis tissues using NBP1-87404 antibody. Corresponding Adenosine Deaminase/ADA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/Adenosine-Deaminase-ADA-Antibody-Immunohistochemistry-Paraffin-NBP1-87404-img0028.jpg)
![Western Blot: Adenosine Deaminase/ADA Antibody [NBP1-87404] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/images2/Adenosine-Deaminase-ADA-Antibody-Western-Blot-NBP1-87404-img0007.jpg)
![Western Blot: Adenosine A2aR Antibody (7F6-G5-A2) [NBP1-39474] - Total protein from mouse brain was separated on a 12% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/mL anti-Adenosine A2a R (7F6-G5-A2) in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/images2/Adenosine-A2a-R-Antibody-(7F6-G5-A2)-Western-Blot-NBP1-39474-img0003.jpg)
![Immunocytochemistry/Immunofluorescence: Adenosine A2aR Antibody (7F6-G5-A2) [NBP1-39474] - Neuro2a cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton X-100. The cells were incubated with anti-Adenosine A2a R (7F6-G5-A2), NBP1-39474, at a 1:50 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.](http://images.novusbio.com/images2/Adenosine-A2a-R-Antibody-(7F6-G5-A2)-Immunocytochemistry-Immunofluorescence-NBP1-39474-img0004.jpg)
![Flow Cytometry: Adenosine A2aR Antibody (7F6-G5-A2) [NBP1-39474] - Using the PE direct conjugate An intracellular stain was performed on SH-SY5Y cells with Adenosine A2a R (7F6-G5-A2) antibody NBP1-39474PE (blue) and a matched isotype control NB600-986PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin (PE).](http://images.novusbio.com/images2/Adenosine-A2a-R-Antibody-(7F6-G5-A2)-Flow-Cytometry-NBP1-39474-img0011.jpg)
![Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Comparative proteome analysis of 3xTg-AD and control samples at different stages of AD. Immunoblot analysis of most regulated hits. Soluble fractions of brain proteins were analyzed from four 2-month-old control and 3xTg-AD mice animals, respectively. Hebp1 and Glo1 levels were consistently elevated in the transgenic animals as compared to wild type controls. Ca1 levels were reduced in transgenic animals. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/47498), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Carbonic Anhydrase I-CA1 Antibody-Western Blot-NBP1-88191-img0015.jpg)
![Immunohistochemistry-Paraffin: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Staining of human rectum shows strong cytoplasmic and nuclear positivity in glandular cells.](http://images.novusbio.com/images2/Carbonic-Anhydrase-I-CA1-Antibody-Immunohistochemistry-Paraffin-NBP1-88191-img0014.jpg)
![Western Blot: Carbonic Anhydrase I/CA1 Antibody [NBP1-88191] - Analysis in human cell line HELA.](http://images.novusbio.com/images2/Carbonic-Anhydrase-I-CA1-Antibody-Western-Blot-NBP1-88191-img0006.jpg)
![Western Blot: IFN-alpha/beta R1 Antibody (SR45-08) [NBP2-67339] - Analysis using Siha cell lysates at 1/500 dilution.](http://images.novusbio.com/images2/IFN-alpha-beta-R1-Antibody-(SR45-08)-Western-Blot-NBP2-67339-img0006.jpg)
![Immunohistochemistry-Paraffin: IFN-alpha/beta R1 Antibody (SR45-08) [NBP2-67339] - Immunohistochemical analysis of paraffin-embedded rat brain tissue using anti-IFN-alpha/beta R1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes. The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (ET1602-37, 1/200) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.](http://images.novusbio.com/images2/IFN-alpha-beta R1 Antibody (SR45-08)-Immunohistochemistry-Paraffin-NBP2-67339-img0007.jpg)
![Flow Cytometry: IFN-alpha/beta R1 Antibody (SR45-08) [NBP2-67339] - Analysis of Jurkat cells with IFNAR1 antibody at 1/50 dilution (blue) compared with an unlabelled control (cells without incubation with primary antibody; red). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.](http://images.novusbio.com/images2/IFN-alpha-beta-R1-Antibody-(SR45-08)-Flow-Cytometry-NBP2-67339-img0001.jpg)
![Western Blot: NLRP3/NALP3 Antibody [NBP2-12446] - C-AR inhibited NLRP3 inflammasome activation in synovial tissue. NLRP3 protein expression in succinate-stimulated synovial fibroblasts. The results were derived from four independent experiments for immunohistochemistry staining and Western blot and expressed as the mean +/- SD. *p < 0.05 vs. the model; #p < 0.05 vs. the indicated treatment. Image collected and cropped by CiteAb from the following publication (http://journal.frontiersin.org/article/10.3389/fimmu.2016.00532/full), licensed under a CC-BY licence.](http://images.novusbio.com/images2/NLRP3-NALP3-Antibody-Western-Blot-NBP2-12446-img0011.jpg)
![Immunohistochemistry-Paraffin: NLRP3/NALP3 Antibody [NBP2-12446] - Analysis of human esophagus using NLRP3/NALP3 antibody at 1:50 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Cytoplasmic staining in the squamous epithelium was observed. Staining was performed by Histowiz.](http://images.novusbio.com/images2/NLRP3-NALP3-Antibody-Immunohistochemistry-Paraffin-NBP2-12446-img0009.jpg)
![Western Blot: NLRP3/NALP3 Antibody [NBP2-12446] - Analysis of NLRP3 in cells (Huh-7 and SMMC-7721) exposed luteoloside using anti-NLRP3 antibody. Western blot image submitted by a verified customer review.](http://images.novusbio.com/images2/NLRP3-NALP3-Antibody-Western-Blot-NBP2-12446-img0005.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in B16F1 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0005.jpg)
![Immunohistochemistry-Paraffin: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Tyrosinase antibody. Counter stained with hematoxylin.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunohistochemistry-Paraffin-NBP2-67232-img0004.jpg)
![Immunocytochemistry/Immunofluorescence: Tyrosinase Antibody (JA52-11) [NBP2-67232] - Staining Tyrosinase in A431 cells (red). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.](http://images.novusbio.com/images2/Tyrosinase-Antibody-(JA52-11)-Immunocytochemistry-Immunofluorescence-NBP2-67232-img0001.jpg)