TCF21 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TCF21 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TCF21
  
  

  Source: E.coli

  Amino Acid Sequence: SSYIAHLRQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TCF21
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25175It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TCF21 Recombinant Protein Antigen

• bHLHa23BHLHA23
• Capsulin
• Class A basic helix-loop-helix protein 23
• epicardin
• Pod-1
• POD1pod-1
• Podocyte-expressed 1
• TCF-21
• transcription factor 21

Background

The basic helix-loop-helix transcription factor TCF21/Pod1 (also called capsulin or epicardin) is involved in kidney, lung and spleen organogenesis. It is also essential for normal development of the testes and ovaries. TCF21/Pod1 is involved in the transcriptional repression of steroidogenic factor 1 (Sf1/Nr5a1/Ad4BP), an orphan nuclear receptor that regulates the expression of multiple genes (including Scc) that mediate sexual differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCF21