TCF19 Antibody - BSA Free

Western Blot: TCF19 Antibody [NBP2-82357] - WB Suggested Anti-TCF19 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: THP-1 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TCF19 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TCF19 Antibody - BSA Free (NBP2-82357) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCF19. Peptide sequence: VSLEDHSSQGTLVNNVRLPRGHRLELSDGDLLTFGPEGPPGTSPSEFYFM The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TCF19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TCF19 Antibody - BSA Free

• SC1(TCF19)-6
• SC1-1
• SC1SC1(TCF19)-7
• SCI(TCF19)-4
• TCF-19
• transcription factor 19
• Transcription factor SC1

Background

The 2.6-kb cDNA encodes a deduced 359-amino acid polypeptide with features characteristic of transactivating factors. The gene was mapped by in situ hybridization to chromosome 6p21-p22. The bacterially expressed protein has the predicted size of 39 kD.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TCF19